Cecropin B Peptide,CAS:80451-05-4
Cecropin B Peptide 
						
						Product description
							Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.Cecropins have lytic and antibacterial activities against several Gram-positive and Gram-negative bacteria by forming membrane channels.
| Appearance | N/A | 
|---|---|
| Molecular weight | N/A | 
| Purity | >90% | 
| Solubility | N/A | 
| Cas | 80451-05-4 | 
| Synonyms | Cecropin-B; Immune protein P9 | 
| Sequence | H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 or H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 | 
| Molecular Formula | C176H302N52O41S1 | 
| Storage | -20℃, protected from light and moisture | 
| Transportation | 4-25℃ temperature for up to 3 weeks | 
| Stability | 1 year | 
Document
							Related Product
							
						
Items-$0.00

Email:
Tel.:
msds      of      Cecropin B Peptide 
                    RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                
                    Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China 
                
                    Tel:  02988811435
                
                    Fax: (86-29)8881-1435
                
                    Email: sales@ruixibiotech.com
                
                    Web: http://www.ruixibiotech.com    
					
							
                

