Defensin-1 (human) HNP-1,CAS :148093-65-6
Defensin-1 (human) HNP-1
| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
|---|---|---|---|---|
| R-M-1642 | 5mg | inquiry | ||
|
|
||||
Product description
Defensin HNP-1 is a peptide secreted by polymorphonuclear leukocytes (PMNs) that has antimicrobial properties. It induces lysis of mammalian cells when used at concentrations of 25 and 100 µg/ml, respectively. Endogenous antibiotic peptide that exhibits a range of prominent anti-microbial activities against bacteria, fungi, and certain enveloped viruses.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 148093-65-6 |
| Sequence | H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt) (Cys2 and 30 bridge, Cys4 and 19 bridge, Cys 9 and 29 bridge)/ACYCRIPACIAGERRYGTCIYQGRLWAFCC (C2&C30 bridg |
| Molecular Formula | C150H222N44O38S6 |
| Storage | -20℃,protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 2 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of Defensin-1 (human) HNP-1
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


