Home > products > peptide
> synthetic-peptide
> pacap-27-human-mouse-ovine-porcine-rat-trifluoroacetate-salt
PACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ trifluoroacetate salt
| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
|---|---|---|---|---|
| R-M-1084 | 0.5mg | 315.00 | + Add to cart |
|
| R-M-1084 | 1mg | 545.00 | + Add to cart |
|
|
|
||||
Product description
PACAP-38 and its N-terminal fragment PACAP-27 are neuropeptides originally isolated from ovine hypothalamus, but also found in humans and rats. Both PACAP-27, which shows considerable homology with vasoactive intestinal polypeptide (VIP), and PACAP-38 stimulate adenylate cyclase much more potently than VIP.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 127317-03-7 |
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂ |
| Synonyms | Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat) |
| Molecular Formula | C₁₄₂H₂₂₄N₄₀O₃₉S |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of PACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


