Prolactin-Releasing Peptide (1-31) (human),CAS:215510-22-8
H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH₂
| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
|---|---|---|---|---|
| R-M-1141 | 0.5mg | 270.00 | + Add to cart |
|
| R-M-1141 | 1mg | 500.00 | + Add to cart |
|
|
|
||||
Product description
CAS:215510-22-8,Prolactin-Releasing Peptide (1-31) (human) from ruixi.It is a synthetic peptide.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 215510-22-8 |
| Sequence | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH₂ |
| Synonyms | PrRP31 (human), Preprolactin (23-53) (human) |
| Molecular Formula | C₁₆₀H₂₅₂N₅₆O₄₂S |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of Prolactin-Releasing Peptide (1-31) (human)
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


