SDF-1β (human) trifluoroacetate salt ,CAS:1927911-05-4
SDF-1β (human) trifluoroacetate salt
Product description
Synthetically produced, contains BSA (low levels of endotoxins) in a ratio of 1:50. CXC chemokine that signals through the CXCR4 receptor and plays critical roles in migration, proliferation and differentiation of leukocytes. Since SDF-1 is involved in several problematic diseases such as AIDS, cancer cell metastasis, leukemia cell progression, rheumatoid arthritis and pulmonary fibrosis CXCR4 represents a therapeutic target for these conditions.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 1927911-05-4 |
| Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Synonyms | Stromal Cell-Derived Factor-1β (human) |
| Molecular Formula | C₃₈₂H₆₂₀N₁₁₄O₉₇S₅ |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of SDF-1β (human) trifluoroacetate salt
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


