(Ser8)-GLP-1 (7-36), amide, human,CAS :215777-46-1
(Ser8)-GLP-1 (7-36), amide, human
Product description
This product is intended for laboratory use only, and it is not meant for human consumption.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 215777-46-1 |
| Sequence | H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt) |
| One letter sequence | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Molecular formula | C149H226N40O46 |
| Storage | -20℃,protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 2 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of (Ser8)-GLP-1 (7-36), amide, human
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


