Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-R-5134	Thieno[3,2-b]thiophene-2,5-dicarbaldehyde CAS No.:37882-75-0	Thieno[3,2-b]thiophene-2,5-dicarbaldehyde/CAS No.:37882-75-0 is a chemical compound with the empirical formula C8H4O2S2 . It is used as a monomer in the synthesis of Covalent Organic Frameworks (COFs) materials . This molecule has been used in the synthesis of novel metal-free organic dyes for Dye-Sensitized Solar Cells, reaching conversion efficiencies of 6.23% . Please inquire in advance to purchase this product.	price>
R-M-991	Nesfatin-1 (human) trifluoroacetate salt，CAS : 917528-35-9	Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research.	price>
R-C-3465	GLP-1-polyethylene glycol350-DSPE	Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification.	price>
R-R-5135	Naphthalene-1,4-dicarbaldehyde CAS No.:38153-01-4	Naphthalene-1,4-dicarbaldehyde/CAS No.:38153-01-4, a chemical compound, is widely used in scientific research due to its diverse applications. This versatile material finds use in organic synthesis, fluorescent labeling, and as a building block for various functional molecules. Its unique properties make it a valuable tool in numerous scientific investigations. Please inquire in advance to purchase this product.	price>
R-M-992	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research.	price>
R-C-3466	Glucagon like peptide-1-PEG550-DSPE	Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification.	price>
R-R-5136	9,10-Anthracenedicarboxaldehyde CAS No.:7044-91-9	9,10-Anthracenedicarboxaldehyde/CAS No.:7044-91-9, also known as Anthracene-9,10-dicarbaldehyde, is an acene-9,10-dialdehyde and an anthracenedialdehyde . It is an aggregation-induced emission luminogens (AIEgens) and is used as a reagent in the preparation of porous imine-linked networks (PINs) . Please inquire in advance to purchase this product.	price>
R-M-993	Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8	Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.	price>
R-C-3467	GLP-1-PEG750-DSPE	Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification.	price>
R-R-5137	2,5-Thiophenedicarboxaldehyde CAS No.:932-95-6	2,5-Thiophenedicarboxaldehyde/CAS No.:932-95-6 is a reagent used in the synthesis of N,N-bis-(mercaptophenylimine)thiophenedicarboxaldehyde Schiff base and functions as an intermediate in many organic syntheses . It is also a natural product found in Capparis spinosa . Please inquire in advance to purchase this product.	price>
R-M-994	nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9	Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.	price>
R-C-3468	HP2 targeting peptide-PEG350-DSPE	HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology.	price>
R-R-5138	[2,2-Bipyridine]-4,4-dicarbaldehyde CAS No.:99970-84-0	[2,2-Bipyridine]-4,4-dicarbaldehyde/CAS No.:99970-84-0 is an intriguing chemical compound used in various scientific research applications. Its unique structure and properties make it suitable for diverse studies, ranging from catalysis to material science. Please inquire in advance to purchase this product.	price>
R-M-995	Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1	Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research.	price>
R-C-3469	HP2-polyethylene glycol550-DSPE	HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology.	price>
R-R-5139	(E)-(diazene-1,2-diylbis(4,1-phenylene))diboronic acid CAS No.:1902168-17-5	(E)-(diazene-1,2-diylbis(4,1-phenylene))diboronic acid/CAS No.:1902168-17-5 is a compound with notable optical and nonlinear optical properties, and it is of interest in the field of materials science for its potential applications in various technologies. Please inquire in advance to purchase this product.	price>
R-M-996	Nesfatin-1-Like Peptide (mouse) trifluoroacetate salt	The insulinotropic peptide encoded by nucleobindin 1 upregulated preproinsulin mRNA expression and insulin secretion.	price>
R-C-3470	HP2-PEG750-DSPE	HER2,also known as c-erb2,consists of 922 adenine,1382 cytosine,1346 guanine and 880 thymine.Peptides, as receptor targeted antitumor carriers, are more and more used to improve the effect of chemotherapeutic drugs. Experiments have also proved that they can improve the antitumor effect by enhancing the targeting specificity of drugs, enhancing the targeted absorption of drugs, and improving the original insoluble of some small molecule drugs. Peptide carrier targeting technology is known as a new generation of targeted drug development technology.	price>
R-R-5140	Boronic acid, (nitrilotri-4,1-phenylene)tris- CAS No.:245737-33-1	Boronic acid, (nitrilotri-4,1-phenylene)tris-/CAS No.:245737-33-1, is a versatile chemical compound used in scientific research. It offers diverse applications due to its unique properties, aiding in various fields of study such as drug delivery systems, bioimaging, and sensor development. Please inquire in advance to purchase this product.	price>
R-M-997	Neural-Cadherin (76-85) amide (chicken),CAS:127650-08-2	This decapeptide resides within the first extracellular domain (EC1) of N-cadherin. It inhibits cadherin-mediated cell adhesion, compaction of eight-cell-stage mouse embryos and rat neurite outgrowth on astrocytes. In the presence of this peptide Ca²⁺-dependent cell aggregation of bovine brain microvessel endothelial cells is prevented. A putative application in creating channels for paracellular drug delivery across blood brain barriers has been proposed.	price>

722723724725726727 728729730731732