Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-C-4249 | DSPE-PEG350-Glycyrrhetinic acid | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid. | price> |
| R-M-4014 | L-ANAP hydrochloride | L-ANAP hydrochloride is a fluorescent unnatural amino acid used as gene coding and polarity sensitive, which is used in imaging biology research. | price> |
| R-M-1743 | Apelin-13 TFA | Apelin-13 is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. | price> |
| R-C-4250 | DSPE-polyethylene glycol550-Glycyrrhetinic acid | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid. | price> |
| R-M-1744 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia. | price> |
| R-C-4251 | Glycyrrhetinic acid-PEG750-DSPE | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.It is a long circulating liposome membrane,formation of micelles in water dispersion,the critical micelle concentration(CMC)ratio of surfactant is 102 times lower,so the drug stability is better,even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting,easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance,which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra.Glycyrrhetinic acid can be regarded as β-A derivative of oleanol,thereby serving as a glycosidic ligand of glycyrrhizic acid. | price> |
| R-M-1745 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | price> |
| R-M-4016 | HBC620,cas: 2530162-07-1 | HBC620 is a non fluorescent HBC simulant. HBC is non fluorescent in solution, but it will emit strong fluorescence when forming a close complex with pepper RNA aptamer. HBC pepper complex can be used to observe the dynamic changes of RNA in living cells. | price> |
| R-C-4252 | DSPE-PEG350-CGP | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. | price> |
| R-M-1746 | TFLLR-NH2(TFA),CAS:1313730-19-6 | TFLLR-NH2 (TFA) is a selective PAR1 agonist with an EC50 of 1.9 μM. | price> |
| R-M-4017 | 9-Aminoacridine,cas:90-45-9 | 9-Aminoacridine (Aminacrine) is a highly fluorescent dye used as a topical antiseptic and experimentally as a mutagen, an intracellular pH indicator. 9-Aminoacridine is an effective antibacterial agent with caries-disclosing features. | price> |
| R-C-4253 | DSPE-polyethylene glycol550-CGP | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. | price> |
| R-M-1747 | NLS (PKKKRKV) hydrochloride | NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research. | price> |
| R-M-4018 | 1,3-Diphenylisobenzofuran,cas:5471-63-6 | 1,3-Diphenylisobenzofuran (DPBF) is a fluorescent probe which possesses a highly specific reactivity towards singlet oxygen (1O2) forming an endoperoxide which decomposes to give 1,2-dibenzoylbenzene. 1,3-Diphenylisobenzofuran can detect the generation of reactive oxygen species (ROS). | price> |
| R-C-4254 | choline glycerophosphatide-PEG750-DSPE | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. | price> |
| R-M-1749 | Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, CAS:116783-35-8 | price> | |
| R-M-4019 | DFHBI-1T,Cas:1539318-36-9 | DFHBI-1T is a membrane permeable RNA aptamer activated fluorescent probe (EX / EM = 472 nm / 507 nm). DFHBI-1T binds to RNA aptamers (spike, Spike 2, ispinach, broccoli) and produces specific fluorescence and low background fluorescence. DFHBI-1T can be used for RNA imaging in living cells. | price> |
| R-C-4255 | DSPE-PEG350-Glucose | Glucose plays an important role in the field of biology. It is the energy source and metabolic intermediate product of living cells, that is, the main energy supply of organisms.DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.Suitable for the development of long circulating liposomes. | price> |
| R-M-1750 | T7 Tag Peptide,CAS: 245445-88-9 | The T7 tag is an epitope tag composed of an 11-residue peptide encoded from the leader sequence of the T7 bacteriophage gene10. Epitope tags are useful for the labeling and detection of proteins using immunoblotting, immunoprecipitation, and immunostaining techniques. The T7 tag is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. The T7 tag has been used extensively as a general epitope tag in many expression vectors including the pET system that is based on T7 RNA polymerase expression systems . | price> |
| R-M-4020 | MOF-5 (Zn) | Metal organic framework material (MOF) is a new porous material with regular pore size, high specific surface area and large pore volume.MOF-5 (Zn) is one of them. Because of its huge specific surface area, it has broad application prospects in adsorption separation, gas capture and storage. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


