Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-C-4629	PEI-PEG-PEI	Copolymers of cationic poly(ethylene imine) (PEI) and polyethylene glycol (PEG) markedly improve in vitro and in vivo delivery of oligonucleotides and nucleic acids (DNA, siRNA). LPEI-b-PEG-b-LPEI can have varying MW of PEI and MW of PEG. PEG-PEI drug conjugates,polyplexes or nanoparticles can be prepared with a dynamic range of size,surface charge, and stability. Properties important to transfection efficiency.	price>
R-M-5295	Thiol-CBAA-PEG550-Amine	Amine-Betaine carboxylate acrylamide-Polyethyleneglycol-Thiol,NH2-CBAA-PEG-SH from ruixi.Ruixi is a biotechnology company. Our company focuses onthe production and sales of scientific research level drug delivery and drugnano targeting products. At present, our products mainly include syntheticphospholipids, PEG derivatives, block copolymers, nano gold, magneticnanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescentquantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4630	Citrate-stabilized Fe3O4 nanoparticles Fe3O4 Size:20nm	(citrate-stabilized) Fe3O4 aqueous colloidal magnetic nanoparticles (CA-MNP) of size 8–10 nm using soft chemical route.The surface functionalization of Fe3O4 nanoparticles with citric acid was evident from infrared spectroscopy, thermal and elemental analyses, and zeta-potential measurements.	price>
R-M-5296	SH-CBAA-PEG750-Amine	Amine-Betaine carboxylate acrylamide-Polyethyleneglycol-Thiol,NH2-CBAA-PEG-SH from ruixi.Ruixi is a biotechnology company. Our company focuses onthe production and sales of scientific research level drug delivery and drugnano targeting products. At present, our products mainly include syntheticphospholipids, PEG derivatives, block copolymers, nano gold, magneticnanoparticles, mesoporous silica, reactive fluorescent dyes, fluorescentquantum dots, click chemistry and macrocyclic ligands.	price>
R-C-4631	DSPE-PEG4-DBCO	DSPE-PEG4-DBCO is a PEG linker containing DSPE and DBCO moieties. The DSPE-PEGs have been FDA approved for medical applications. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. The DBCO group can be used for copper-free Click Chemistry reactions. Reagent grade, for research use only.	price>
R-C-4632	DSPE-PEG8-Mal	The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. Maleimide groups can react with thiols between pH 6.5 to 7.5.	price>
R-M-5298	BDP R6G hydrazide	BDP R6G is a borondipyrromethene dye whose absorption and emission spectra resemble those of R6G (rhodamine 6G). This hydrazide is a carbonyl-reactive compound that is useful for the labeling of aldehydes, ketones, and most carbohydrates (oxidized with periodate).	price>
R-C-4633	DSPE-PEG12-Mal	DSPE-PEG12-Mal is a PEG linker containing DSPE and maleimide moieties. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The maleimide group will react with a thiol group to form a covalent bond, enabling the connection of biomolecule with a thiol. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug.	price>
R-M1-8751	NH2-PEG3-Biotin	Amine-peg3-Biotin/Biotin-peg3-Amine/Biotin-peg3-NH2/NH2-PEG3-Biotin provides a versatile tool for biotin-mediated binding and immobilization in various biological or analytical applications.	price>
R-M-5299	BDP R6G tetrazine	BDP R6G is a borondipyrromethene dye that has absorption and emission wavelengths close to rhodamine 6G (R6G). BDP R6G is a very bright and photostable dye.Tetrazine fragment is used in inverse electron demand Diels Alder reaction with trans-cyclooctenes, acylazetines, and other strained olefins.	price>
R-C-4634	DSPE-PEG-Iodoacetyl	DSPE-PEG-Iodoacetyl , MW 2,000 is a thiol reactive phospholipid polyPEG. The iodoacetyll group is reactive with thiol to produce a thioether linkage. The polymer can self-assemble in water to form lipid bilayer and can be used to encapsulate drugs in targeted delivery application, such as liposomal doxorubicin as an anti cancer drug or mRNA vaccine.	price>
R-M1-8752	TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR	TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECATSLNPDYREEDTDVR is a peptide sequence that can be used for drug delivery and targeted research.	price>
R-M-5300	BDP-FL-Hydrazide,cas:2183473-45-0	BDP-FL-Hydrazide from ruixi.BDP FL is a bright and photosensitive fluorophore used in fam filter group. This fluorophore is very suitable for microscopy and fluorescence polarization technology. The hydrazide function allows easy binding to carbonyl compounds such as aldehydes and ketones.	price>
R-C-4635	DSPE-PEG-Boronate	1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-Boronate is a phospholipid PEG polymer which can form lipid bilayer in aqueous solution. Phenyl boronic acid (PBA) moiety has been most widely studied and used in construction of glucose-responsive systems for insulin delivery. Additionally, PBA materials have been used to prepare nanoparticles/micelles for delivering therapeutic agents, such as proteins, SiRNA, anti cancer agent, etc.	price>
R-M1-8753	CY7-curcumin	Cyanine7-curcumin/Curcumin,Cyanine7 labed/CY7-curcumin is a fluorescent labeled molecular compound that can be used in research fields such as cell tracking and fluorescence imaging.	price>
R-M-5301	BDP TMR tetrazine	BDP TMR, an orange-fluorescent dye and a full analog of BODIPY™ . Because of its small size and relatively long excitation lifetime, this fluorophore can be used for studying ligand-receptor interactions based on fluorescence polarization.A tetrazine fragment in the molecule can rapidly react with trans-cyclooctene and cyclopropene derivatives in cycloaddition reactions, which result in stable biomolecule-fluorophore conjugates.	price>
R-C-4636	DSPE-PEG-Vinylsulfone	1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-Vinylsulfone is a self-assembling PEG reagent which forms lipid bilayer. The amphiphilic polymer can be used to prepare liposome for delivering therapeutics, such as nucleic acid (mRNA/DNA) or protein. The vinyl sulfone moiety is reactive with cysteine or other thiol molecule via thiol-ene chemistry.	price>
R-M1-8754	Cy5.5-curcumin	Cyanine5.5-curcumin/Curcumin,Cyanine5.5 labed/CY5.5-curcumin is a fluorescent labeled molecular compound that can be used in research fields such as cell tracking and fluorescence imaging.	price>
R-M-5302	BDP-TMR-Alkyne	BDP TMR is a fluorophore for TAMRA filter sets that is significantly brighter than TAMRA due to its high quantum yield. This alkene derivative can be coupled with azides in a copper catalyzed click chemistry reaction.	price>
R-C-4637	DSPE-PEG4-acid	1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-acid is a PEG linker containing DSPE and carboxylic acid moietiesThe hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug.	price>

888889890891892893 894895896897898