Home > Keywords >
Catalog | name | Description | price |
---|---|---|---|
R-M-5408 | 5(6)-Rhodamine Green maleimide | 5(6)-Rhodamine Green maleimide,5(6)-carbonylated rhodamine 110 maleimide from ruixi.Rhodamine green is 5(6)-carbonylated rhodamine 110.Rhodamine Green has excellent optical properties, good light stability, very bright fluorescence brightness, and is insensitive to pH between pH 4-9. The fluorescence spectrum of rhodamine green is very close to that of fluorescein, Oregon green and FITC, and the extinction coefficient is similar to the quantum yield, but the photostability and pH stability are much better, so it is a perfect substitute for them.Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling. | price> |
R-C-4743 | MAL-TK-PEG750-DSPE | DSFE phospholipids have the function of emulsifying and solubilizing drugs as pharmaceutical excipients. Modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. Common modification methods include:; Introduce polymer to improve the blood circulation time and disintegration time of the preparation; Introducing rabbit epidemic factor to enhance targeting; Introduce markers for diagnosis and tracking. | price> |
R-M1-8861 | CY5.5-tryptophan | CY5.5-tryptophan conjugate can be utilized in fluorescence-based studies, allowing for the visualization, tracking, and analysis of tryptophan-containing peptides or proteins in biological systems. This labeled compound could be applied in research areas such as protein-protein interactions, receptor-ligand binding studies, and bioimaging, providing insights into the behavior and localization of tryptophan-containing molecules. | price> |
R-M-5409 | 5(6)-Rhodamine 6G NHS ester | 5(6)-Rhodamine 6G NHS ester from ruixi.Rhodamine 6G is one of the rhodamine family dyes with high fluorescence properties, showing yellow green fluorescence. In life science research, it is often used as tracking dye in detection methods such as fluorescence microscope, flow cytometer and enzyme labeling instrument. Rhodamine 6G has good water solubility and its fluorescence spectrum is between FITC and Cy3. It is economical and has a wide range of applications. NHS activated ester (N-hydroxysuccinimide ester, successful ester, Se) is the most commonly used activated group in biomarker reaction. NHS activates the carboxyl group in the dye molecule, so that it can react with the amine group (main primary amine) on the target biological molecule to form a stable amide bond, so as to label the dye molecule on the biological macromolecule. | price> |
R-C-4744 | DSPE-PEG-GSH | DSPE phospholipids have the functions of emulsification and drug solubilization as pharmaceutical excipients, and are important materials for slow-release and controlled-release drug preparations such as liposomes, fat emulsions and nanoparticles in recent years. The modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. GSH is a blood-brain barrier shuttle peptide that can transport NPs to the blood-brain barrier through GSH transport protein. | price> |
R-M1-8862 | TAT (YGRKKRRQRRR)-PEG2k-NH2 | TAT (YGRKKRRQRRR)-PEG2k-NH2 compound likely serves as a versatile tool for modifying cargoes with the TAT peptide sequence, allowing for enhanced cell penetration and delivery. It can be used to attach various cargo molecules, drugs, or imaging agents to facilitate their cellular uptake, potentially offering utility in drug delivery systems, gene transfection, or the development of targeted imaging probes for cellular and in vivo applications. | price> |
R-M-5410 | 5(6)-Rhodamine 6G amine | Rhodamine 6G is one of the rhodamine family dyes with high fluorescence properties, showing yellow green fluorescence. In life science research, it is often used as tracking dye in detection methods such as fluorescence microscope, flow cytometer and enzyme labeling instrument. Rhodamine 6G has good water solubility and its fluorescence spectrum is between FITC and Cy3. It is economical and has a wide range of applications. (5 (6) - Rhodamine 6G amine) the product contains amino functional groups and can react with functional groups such as carboxylic acid. 6 carbon short chain helps to separate dye molecules from labeled objects, improve labeling efficiency and reduce the impact of labeled objects on dye molecules. | price> |
R-C-4745 | DSPE-PEG350-Glutathione | DSPE phospholipids have the functions of emulsification and drug solubilization as pharmaceutical excipients, and are important materials for slow-release and controlled-release drug preparations such as liposomes, fat emulsions and nanoparticles in recent years. The modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. GSH is a blood-brain barrier shuttle peptide that can transport NPs to the blood-brain barrier through GSH transport protein. | price> |
R-M1-8863 | Pro-His-Ser-Arg-Asn(PHSRN) | Pro-His-Ser-Arg-Asn (PHSRN) is a specific sequence of amino acids, also known as a peptide, that serves as a recognition site for integrin receptors in the extracellular matrix of cells. Integrins are cell surface receptors that play a crucial role in cell adhesion, migration, and signal transduction. | price> |
R-M-5411 | 5(6)-Rhodamine 6G maleimide | 5(6)-Rhodamine 6G maleimide from ruixi. Rhodamine 6G is one of the rhodamine family dyes with high fluorescence properties, showing yellow green fluorescence. In life science research, it is often used as tracking dye in detection methods such as fluorescence microscope, flow cytometer and enzyme labeling instrument. Rhodamine 6G has good water solubility and fluorescence spectrum between FITC and Cy3. It is economical and has a wide range of applications Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling. | price> |
R-C-4746 | DSPE-polyethylene glycol550-GSH | DSPE phospholipids have the functions of emulsification and drug solubilization as pharmaceutical excipients, and are important materials for slow-release and controlled-release drug preparations such as liposomes, fat emulsions and nanoparticles in recent years. The modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. GSH is a blood-brain barrier shuttle peptide that can transport NPs to the blood-brain barrier through GSH transport protein. | price> |
R-M1-8864 | mPEG2000-CPP30 | mPEG2000-CPP30/mPEG2000-CPP30(RLYMRYYSPTTRRYG)/mPEG2k-CPP30/mPEG2k-RLYMRYYSPTTRRYG may find application in drug delivery systems, molecular imaging, and other biotechnological and biomedical research fields where improving cellular uptake and targeting is necessary. | price> |
R-M-5412 | 5(6)-RBITC | 5(6)-RBITC is an isocyanate of Rhodamine B, which can be used to label amino functional groups. Compared with NHS activated ester, isocyanate is more stable, but the reaction activity is lower than NHS activated ester. | price> |
R-C-4747 | DSPE-PEG750-Glutathione | DSPE phospholipids have the functions of emulsification and drug solubilization as pharmaceutical excipients, and are important materials for slow-release and controlled-release drug preparations such as liposomes, fat emulsions and nanoparticles in recent years. The modification of phospholipid molecules can make these preparations have the ability to release and target under specific conditions. GSH is a blood-brain barrier shuttle peptide that can transport NPs to the blood-brain barrier through GSH transport protein. | price> |
R-M1-cs8865 | Ni@Au Core-shell nanoparticles | Ni@Au core-shell nanoparticles/ Ni-Au core-shell nanoparticles are nanostructures consisting of a nickel (Ni) core surrounded by a shell of gold (Au). These hybrid nanoparticles combine the properties of both nickel and gold, offering a unique combination of attributes that make them valuable in various applications.The nickel core provides magnetic properties, allowing the nanoparticles to be manipulated using external magnetic fields. This magnetic behavior can be harnessed for applications such as magnetic separation, targeted drug delivery, and magnetic resonance imaging (MRI) contrast agents.The gold shell offers several advantageous features, including its biocompatibility, stability, and ease of functionalization with a variety of molecules. As a result, Au-coated nanoparticles are frequently used in biomedical applications, such as targeted drug delivery, photothermal therapy, and bioimaging. | price> |
R-M-5413 | 5(6)-TAMRA-maleimide | 5(6)-TAMRA-maleimide,5(6)-Tetramethylrhodamine-maleimide from ruixi.Tetramethylrhodamine,namely tetramethylrhodamine (TMR, Tamra), is a fluorescent dye commonly used in biological coupling. It is often used to connect antibodies, avidin and so on for immunochemistry. TMR and Tamra are the common names of this dye in the literature. Tamra generally introduces carboxylic acid at position 5 or 6 for labeling. Maleimide is a group commonly used in biomarker reaction. It can generate stable thioether structure through affinity addition reaction with sulfhydryl (- SH), so as to realize labeling. Although amino groups (such as lysine arginine side chain) also have affinity, maleimide selectively labels sulfhydryl groups in neutral or slightly acidic buffer (reaction speed > 1000 times faster than amino groups). The labeling reaction has the advantages of rapid reaction, high selectivity and good yield. In addition, sulfhydryl is a functional group widely existing in biomolecules, such as serine and disulfide bond in proteins. Therefore, maleimide / thiol labeling has become the most commonly used biological ligation reaction second only to NHS / amino labeling. | price> |
R-C-4748 | PLL-Cholic acid | PLL-CA,Cholic acid is the main component of bile acid. It is insoluble in water, soluble in ethanol and acetic acid. Its solid state is white crystal, and its salts are called bile salts. The derivatives of cholic acid are mainly produced by cholic acid - coenzyme A, in which CoA can exchange with glycine or taurine to produce glycine cholic acid or taurocholic acid. | price> |
R-M1-8866 | 5-TTTTTTTT-TTAGGGCATGCACTAC-FITC-3 | This type of DNA sequence is commonly used for molecular biology and genetic research purposes, such as in fluorescence in situ hybridization (FISH) or other fluorescent labeling assays. In this case, the FITC molecule allows for the visualization and detection of the DNA sequence within a biological sample or experimental assay, as FITC emits green fluorescence when excited by appropriate light.The DNA sequence itself, "GGGCATGCACTAC," could potentially serve as a probe for targeting complementary sequences or specific genetic regions in research applications, while the presence of the FITC label enables visualization and tracking of the labeled DNA sequence within a biological context. | price> |
R-M-5414 | 5(6)-TRITC | 5(6)-TRITC,Tetramethylrhodamine isothiocyanate, 5 and 6 isomers from ruixi.5(6)-TRITC is an isocyanate of tetramethylrhodamine (Tamra), which can be used to label amino functional groups. Compared with NHS activated ester, isocyanate is more stable, but the reaction activity is lower than NHS activated ester. | price> |
R-M1-8867 | CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR | This sequence(CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR) represents a linear chain of amino acids that would fold and interact with other molecules to form the functional three-dimensional structure of a protein or peptide. The specific function or properties of the protein or peptide corresponding to this sequence would depend on its overall structure, interactions with other molecules, and cellular context. | price> |