| Catalog | name | Description | price |
|---|---|---|---|
| R-M1-8759 | NapGFFYEEYCWSQYLCYOH | NapGFFYEEYCWSQYLCYOH is a peptide sequence that can be used for drug delivery and targeted research. | price> |
| R-MG-001 | GE11(YHWYGYTPQNVI) | GE11 peptide is composed of 11 amino acids (yhwygytpqnvi).Ge11 modified micelles are targeting EGFR.The results show that the prepared active targeting EGFR micelles accelerate the cell uptake of drugs,and EGFR is overexpressed on the surface of non-small cell lung cancer.GE11,a target peptide of EGFR,has been widely used in tumor targeted delivery of genes and drugs.Phospholipid micelles have good tumor tissue penetration,and the introduction of targeted phospholipid micelles may obtain better drug aggregation effect in tumor tissues. | price> |
| R-M1-8778 | CGRGDSY | CGRGDSY is a peptide sequence that represents a cell adhesion motif. It stands for Cysteine-Glycine-Arginine-Glycine-Aspartic acid-Serine-Tyrosine. This peptide sequence is derived from fibronectin, a glycoprotein found in the extracellular matrix.Due to its importance in mediating cell adhesion and interactions with the extracellular matrix, the RGDS motif is widely used in various biomedical applications. It can be incorporated into biomaterials, such as synthetic polymers or hydrogels, to enhance cell adhesion and promote tissue regeneration. The RGDS motif can also be conjugated to nanoparticles or used as a peptide ligand to target specific cell populations in drug delivery or tissue engineering applications. | price> |
| R-M1-8821 | Collagen binding peptide(LHERHLNNN) | Collagen binding peptide (LHERHLNNN) is a short peptide sequence that has been identified to have a high affinity for collagen, which is the main structural protein found in connective tissues.The LHERHLNNpeptide sequence contains specific amino acids that interact with collagen, allowing for the specific recognition and binding to collagen fibers. The peptide binding affinity and specificity for collagen make it a valuable tool in various biomedical and biotechnological applications, particularly those involving the interaction with and modification of collagen-rich tissues or materials. | price> |
| R-M1-8826 | Fmoc-L-Dap(Boc-AEEA)-OH | Fmoc-L-Dap(Boc-AEEA)-OH is a protected form of diaminopimelic acid suitable for solid-phase peptide synthesis that enables the introduction of Dap residues into peptide sequences for subsequent modifications or specific structural motifs. | price> |
| R-M1-8845 | Fmoc-Ala-Ala-Asn(Trt)-OH | Fmoc-Ala-Ala-Asn(Trt)-OH is an important intermediate for ADC peptide linker or peptide prodrug. | price> |
| R-M1-8863 | Pro-His-Ser-Arg-Asn(PHSRN) | Pro-His-Ser-Arg-Asn (PHSRN) is a specific sequence of amino acids, also known as a peptide, that serves as a recognition site for integrin receptors in the extracellular matrix of cells. Integrins are cell surface receptors that play a crucial role in cell adhesion, migration, and signal transduction. | price> |
| R-M1-8867 | CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR | This sequence(CIKNRDGCQPDGSQGNCCSGYCHKEPGWVAGYCR) represents a linear chain of amino acids that would fold and interact with other molecules to form the functional three-dimensional structure of a protein or peptide. The specific function or properties of the protein or peptide corresponding to this sequence would depend on its overall structure, interactions with other molecules, and cellular context. | price> |
| R-M1-ct8869 | EBNAl562-570:FMVFLQTHI | The notation "EBNA1 562-570:FMVFLQTHI" represents a specific sequence derived from the Epstein-Barr virus nuclear antigen 1 (EBNA1). The sequence "FMVFLQTHI" corresponds to amino acids 562 to 570 of the EBNA1 protein.Epstein-Barr virus (EBV) is a member of the herpesvirus family and is known to cause infectious mononucleosis (glandular fever). The EBNA1 protein is expressed during latent infection and is involved in maintaining the viral genome in latently infected cells. | price> |
| R-M1-8870 | LMP2A426-434:CLGGLLTMV | The notation "LMP2A426-434:CLGGLLTMV" represents a specific sequence derived from the Epstein-Barr virus (EBV) latent membrane protein 2A (LMP2A). The sequence "CLGGLLTMV" corresponds to amino acids 426 to 434 of the LMP2A protein.LMP2A is a protein encoded by EBV that has been implicated in viral latency and immune evasion. Sequence notations like "LMP2A426-434:CLGGLLTMV" are commonly used in the context of immunological research and vaccine development. This sequence may serve as an epitope or antigenic determinant for immune responses and could be a target for studying the interactions of the EBV virus with the immune system. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


