Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M-4009	7-Aminoactinomycin D,Cas:7240-37-1	7-Aminoactinomycin D is a fluorescent DNA dye for apoptosis and flow cytomtery studies.	price>
R-C-4245	Angiopep-PEG750-DSPE	1, 2-Distearoyl-sn-glycero-3-phosphoethanolamine-Poly(ethylene glycol)(DSPE-PEG)is a widely used phospholipids-polymer conjugate in drug delivery applications.It is a biocompatible,biodegradable and amphiphilic material which can also be functionalized with various biomolecules for specific functions.Angiopep-2 (ANG)can target low density lipoprotein receptor associated protein(LRP)on the surface of cerebral capillary endothelial cells (BCECs) and show high BBB transport capacity.	price>
R-M-1739	HAE,CAS : 64111-99-5	HAE is a 3-amino acid peptide which consists of histidine, alanine and glutamate.	price>
R-M-4010	DAF-FM DA ,cas:254109-22-3	DAF-FM DA is a reagent to detect and quantify low concentrations of nitric oxide (NO); DAF-FM fluorescence can be detected by any instrument that can detect fluorescein, including flow cytometers, microscopes, fluorescent microplate readers and fluorometers.	price>
R-M-1740	[bAla8]-Neurokinin A(4-10)	[bAla8]-Neurokinin A(4-10) is a NK2 receptor agonist (pD2 = 6.91). Produces bladder contraction and bronchospasm in guinea pigs in vivo.	price>
R-M-4011	FAM NHS ester, 6-isomer	Fluorescein (FAM) is a bright fluorophore that has found an extremely wide application in life science research. The fluorophore is hydrophilic and its derivatives possess good solubility in aqueous buffers.Fluorescein is compatible with a wide variety of fluorescent instrumentation - most instruments are equipped with FAM channel filters.	price>
R-M-4012	Cy2-SE (iodine),cas:186205-33-4	CY2-SE (Cyanine2 Succinimidyl Ester) is a dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. Excitation (nm):492, Emission (nm): 510.	price>
R-M-1741	c-Myc Peptide Trifluoroacetate	c-Myc Peptide Trifluoroacetate is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription.	price>
R-M-4013	CY7-SE triethylamine	CY7-SE triethylamine is a fluorescence labeling agent (Ex=700-770 nm, Em=790 nm). Cyanine dyes are used to label proteins, antibodies, peptides, and oligonucleotides.	price>
R-M-1742	V5 Epitope Tag Peptide Trifluoroacetate	V5 Epitope Tag Peptide Trifluoroacetate is a Tag Peptide derived from a small Epitope on P and V proteins of monkey-virus paramyxovirus.	price>
R-C-4249	DSPE-PEG350-Glycyrrhetinic acid	DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid.	price>
R-M-4014	L-ANAP hydrochloride	L-ANAP hydrochloride is a fluorescent unnatural amino acid used as gene coding and polarity sensitive, which is used in imaging biology research.	price>
R-M-1743	Apelin-13 TFA	Apelin-13 is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM.	price>
R-C-4250	DSPE-polyethylene glycol550-Glycyrrhetinic acid	DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid.	price>
R-M-1744	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia.	price>
R-C-4251	Glycyrrhetinic acid-PEG750-DSPE	DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.It is a long circulating liposome membrane,formation of micelles in water dispersion,the critical micelle concentration(CMC)ratio of surfactant is 102 times lower,so the drug stability is better,even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting,easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance,which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra.Glycyrrhetinic acid can be regarded as β-A derivative of oleanol,thereby serving as a glycosidic ligand of glycyrrhizic acid.	price>
R-M-1745	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.	price>
R-M-4016	HBC620,cas: 2530162-07-1	HBC620 is a non fluorescent HBC simulant. HBC is non fluorescent in solution, but it will emit strong fluorescence when forming a close complex with pepper RNA aptamer. HBC pepper complex can be used to observe the dynamic changes of RNA in living cells.	price>
R-C-4252	DSPE-PEG350-CGP	DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system.	price>
R-M-1746	TFLLR-NH2(TFA),CAS:1313730-19-6	TFLLR-NH2 (TFA) is a selective PAR1 agonist with an EC50 of 1.9 μM.	price>

835836837838839840 841842843844845