ACTH (1-39) (human) trifluoroacetate salt

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

Product description

ACTH (1-39) (human) trifluoroacetate salt (CAS: 12279-41-3) is a major regulator of adrenocortical function, and also an adrenocorticotropic hormone that stimulates steroid synthesis.

Appearance	N/A
Molecular weight	N/A
Purity	>95%
Solubility	N/A
Cas	12279-41-3
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Synonyms	Corticotropin
Molecular Formula	C₂₀₇H₃₀₈N₅₆O₅₈S
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

MSDS of ACTH (1-39) (human) trifluoroacetate salt

Related Product

• biotinyl-acth-1-39-human-trifluoroacetate-salt