Endotrophin (mouse) trifluoroacetate salt,CAS:1678414-54-4
Endotrophin (mouse) trifluoroacetate salt
Product description
Endotrophin is a carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 1678414-54-4 |
| Sequence | TEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV |
| Molecular Formula | C₃₄₅H₅₂₀N₉₂O₁₀₆S₇ |
| Storage | -20℃,protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 2 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
Endotrophin (mouse) trifluoroacetate salt
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


