Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-9544	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG is a versatile molecule potentially applicable in various scientific and medical fields.It could be utilized for effective drug delivery, targeted therapy, or research into cell biology and interactions.	price>
R-C-7106	DSPE-PEG-iRGD-FITC	DSPE(1,2-distearoyl-sn-glycerin-3-phosphoethanolamine) As a hydrophobic fatty acid tail, it can be stably embedded in the hydrophobic layer of liposomes or nanocarriers, providing structural stability.PEG-iRGD-FITC is a hydrophilic head that is amphiphilic as a whole, making it easy to insert into the surface of liposomes or other nanocarriers and achieve stable membrane anchoring.	price>
R-M-7014	IRDye® 700 Phosphoramidite,cas:648882-22-8	IRDye 700 Phosphoramidite has been optimized for the 700 nm channel of the LI-COR 4300 DNA Analysis System.	price>
R-C-5527	DSPE-Se-Se-PEG-ADA	The presence of diselenide bonds in DSPE-Se-Se-PEG-ADA allows for its redox-responsive behavior. Under specific conditions,such as the presence of high levels of reducing agents,the diselenide bonds can be cleaved, leading to the release of the ADA enzyme from the liposomes.This property can be exploited to trigger the controlled release or activation of ADA in the targeted cells or tissues.	price>
R-M2-9545	Cholesterol-PEG2000-RVG29PPP(D-RVG29)	Cholesterol-PEG2000-RVG29PPP(D-RVG29) represents a promising strategy for targeted therapeutics, primarily in neurological contexts.The conjugate can encapsulate and deliver various therapeutic agents (small molecules, peptides, nucleic acids) directly to neuronal tissues. Given the ability of RVG29 to cross the blood-brain barrier, this conjugate could be used to treat neurodegenerative diseases (like Alzheimer’s or Parkinson’s disease) or CNS tumors.Can potentially be utilized to deliver genetic materials (such as siRNA or plasmids) into neural cells to address genetic disorders or modulate gene expression.Potential applications in neuroimaging or as a vector for imaging agents to enhance the detection of CNS disorders.	price>
R-M-7015	IRDye® 800 Phosphoramidite,cas:211380-08-4	IRDye 800 Phosphoramidite has been optimized for the 800 nm channel of the LI-COR 4300 DNA Analysis System.	price>
R-C-5528	Ytterbium 99.9% metals basis CAS：7440-64-4	Ytterbium (Yb) with a purity of 99.9% on a metals basis refers to a highly purified form of the element ytterbium. Ytterbium is a rare earth metal belonging to the lanthanide series of elements on the periodic table.	price>
R-M2-9546	DMG-PEG2000-RVG29PPP(D-RVG29)	The DMG-PEG2000-RVG29PPP(D-RVG29) construct represents a sophisticated approach to enhance drug delivery systems, particularly for targeting the central nervous system. The integration of DMG with PEG and RVG29 allows for improved solubility and specific targeting abilities, making this construct suitable for a wide range of therapeutic applications in CNS disorders. Potential use in imaging techniques for neurological conditions, acting as a vector for radiolabeled compounds or contrast agents to enhance visualization in medical imaging.	price>
R-C-7108	PBAE-TK-mPEG	mPEG-TK-PBAE,PBAE thioketal(TK)-mPEG(poly β-aminoester thione bond methoxypolyethylene glycol)is an intelligent drug carrier material that combines the biodegradability of poly β-aminoester,the oxidative stress response of thione bond,and the long cycling properties of methoxypolyethylene glycol.It is suitable for targeted therapy of tumors,treatment of inflammatory diseases,and gene delivery.	price>
R-C-5529	18:1 PDP PE CAS:474944-13-3 DOPE-SPDP	DOPE stands for 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine. It is a phospholipid commonly found in liposomes or lipid nanoparticles used for drug delivery. DOPE provides stability and fluidity to the lipid bilayer, facilitating the encapsulation and delivery of therapeutic agents.SPDP stands for N-succinimidyl 3-(2-pyridyldithio) propionate. It is a bifunctional cross-linking reagent used to link molecules together in bioconjugation reactions.	price>
R-M2-9547	Cholesterol-PEG-CD38(ARGDYYGSNSLDYW)	The Cholesterol-PEG-CD38(ARGDYYGSNSLDYW) construct represents a sophisticated approach for drug delivery, combining the cellular targeting capabilities of a peptide with the solubility-enhancing properties of PEG and the membrane fusion properties of cholesterol. Its design allows for specific applications in therapeutic and diagnostic fields, primarily within oncology and immunology.Cholesterol-PEG-CD38(ARGDYYGSNSLDYW)could be employed to deliver chemotherapeutic agents specifically to tumor cells expressing CD38, allowing for localized therapy with reduced systemic toxicity.It can be used in the formulation of vaccines where targeting immune cells is necessary to enhance vaccine efficacy.	price>
R-C-7109	PLGA-PEG-Taurine	Taurine-PEG-PLGA,PLGA-PEG-Taurine is a multifunctional biomaterial composed of poly(lactic acid glycolic acid)copolymer(PLGA),polyethylene glycol(PEG),and taurine.Its design combines degradability,hydrophilicity,and biological activity,and has important application value in the fields of drug delivery and tissue engineering.	price>
R-M-7017	1,1- diethyl-2,2- cyanogen iodide,cas:977-96-8	1,1-diethyl-2,2-cyanogen iodide is a functional dye for membrane potential monitoring and cell tracing.	price>
R-C-5530	PCL3K-TK-PEG5k-Gal	PCL3K-TK-PEG5k-Gal is a complex molecule designed for targeted drug delivery in cancer therapy. It combines a biodegradable polyester (PCL3K) as a structural component, thymidine kinase (TK) as a therapeutic agent, polyethylene glycol (PEG5k) for improved stability and solubility, and galactose (Gal) as a targeting ligand to specifically target cancer cells. This combination enables targeted drug delivery to cancer cells, potentially enhancing the effectiveness of cancer treatment while minimizing side effects on non-cancerous cells.	price>
R-M2-9548	DMG-PEG-CD38	DMG-PEG-CD38/DMG-PEG-ARGDYYGSNSLDYW is a multifunctional conjugate that utilizes the benefits of lipid modification, PEGylation, and a targeting peptide sequence to improve the delivery of therapeutic agents. Targeting peptides, in particular, are powerful tools in modern therapeutic strategies, enabling the development of more effective and less toxic treatment options. Further development and optimization of this conjugate could advance its use in targeted drug delivery, diagnostic applications, or therapeutic innovations.	price>
R-C-7110	DSPE-PEG-L-DOPA	DSPE-PEG-levodopa,L-DOPA-PEG-DSPE,The biofilm fusion ability is provided by distearoyl phosphatidylethanolamine(DSPE),the hydrophilicity and stability are enhanced by polyethylene glycol(PEG),and levodopa(L-DOPA)is used as the active ingredient to bind to dopamine receptors.	price>
R-M-7018	3,3-di-n-pentyloxazole dicarbonylcyanine iodide,cas:53213-92-6	3,3-di-n-pentyloxazole dicarbonylcyanine iodide is a functional dye for membrane potential monitoring and cell tracing.	price>
R-C-5531	DOPE-HA	DOPE-HA is a conjugation system that combines DOPE with HA to create targeted drug delivery systems. By leveraging the properties of DOPE for lipid-based delivery and HA for specific receptor targeting,it offers potential benefits in cancer therapy and other applications where specific targeting and efficient drug delivery are desired.	price>
R-M2-9549	N3-C4-NHS ester,cas478801-48-8	N3-C4-NHS ester,cas478801-48-8 is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It is also a noncleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs). It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.	price>
R-C-7111	DSPE-PEG-JPH203	JPH203-PEG-DSPE,DSPE-PEG is a commonly used nanocarrier material that is widely used in drug delivery, gene transfection, and other fields by prolonging blood circulation time,improving drug stability,and encapsulation efficiency.JPH203(KYT-0353)is an inhibitor of L-type amino acid transporter 1(LAT-1)with effectiveness and specificity.	price>

103010311032103310341035 10361037103810391040