Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-9542	Mal-PEG4-trimethylammonium chloride	Mal-PEG4-trimethylammonium chloride is a versatile reagent that combines the benefits of maleimide-mediated bioconjugation with the properties of polyethylene glycol (PEG) and cationic trimethylammonium groups. The maleimide functionality allows for selective conjugation of fluorescent dyes, drugs, or other molecules to proteins, enabling their use in imaging, tracking, or therapeutic applications.The positively charged trimethylammonium can facilitate the formation of nanoparticles or complexes that enhance the delivery of nucleic acids (like DNA or RNA) or other therapeutics into cells. The compound can be used to create ADCs by linking a cytotoxic drug to an antibody via the maleimide group, allowing targeted delivery of the drug to cancer cells.It can be used to modify surfaces of medical devices or scaffolds to improve biocompatibility or enable further functionalization.	price>
R-C-7104	DSPE-PEG-Ser-Phe-His-Gln-Phe-Ala-Arg-Ala-Thr-Leu-Ala-Ser	DSPE-PEG-Ser-Phe-His-Gln-Phe-Ala-Arg-Ala-Thr-Leu-Ala-Ser is a targeted delivery system composed of phospholipids,polyethylene glycol(PEG),and specific amino acid sequences,commonly used in drug delivery,gene therapy,and other fields. In the construction of liposome nanoparticles,DSPE-PEG regulates surface properties, enhances drug stability and targeting.	price>
R-M-7012	IRDye® 800RS NHS Ester	IRDye 800RS NHS ester is an excellent choice for nucleic acid applications. This near-infrared fluorescence dye has good water solubility, but low salt tolerance. It is more hydrophobic than IRDye 800CW.IRDye 800RS NHS ester can be used to label the primary and secondary amino groups of DNA and RNA. Nucleic acids that have been labeled with IRDye 800RS can be easily purified by reverse-phase chromatography.	price>
R-C-5525	DSPE-PEG2000-SS-RGD	DSPE stands for 1,2-distearoyl-sn-glycero-3-phosphoethanolamine,which is a phospholipid derivative commonly used in drug delivery systems.PEG2000 refers to polyethylene glycol 2000,a polymer that provides stability and solubility to the compound. SS can be cleaved in response to specific stimuli such as the presence of reducing agents. RGD is the abbreviation for the amino acid sequence Arg-Gly-Asp,which is a recognition motif for integrin receptors commonly found on cells.	price>
R-M2-9543	Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	Cholesterol-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG/YGMSPRNRTGSNKPNCIRAIWPTFTEPDG-PEG1000-Cholesterol is a sophisticated biomolecule consisting of cholesterol for membrane engagement, PEG for solubility and circulation enhancement, and a specific peptide for targeted delivery or bioactivity. Such conjugates are increasingly utilized in research and clinical applications, especially for drug delivery systems and targeted therapies, due to their inherent advantages in enhancing stability, providing targeting capabilities, and reducing side effects.	price>
R-C-7105	DSPE-PEG-GPC3(DHLASLWWGTEL)	GPC3(DHLASLWWGTEL)-PEG-DSPE,DSPE-PEG-GPC3(DHLASLWWGTEL)is a targeted functionalized lipid polyethylene glycol peptide complex designed specifically for targeted delivery systems.Its core function is to achieve precise targeting of GPC3 overexpressing tumors such as liver cancer by specifically binding to the Glypican-3 (GPC3)receptor through the peptide sequence(DHLASLWWGTEL).	price>
R-M-7013	IRDye® QC-1 NHS Ester	IRDye QC-1 is the first non-fluorescent (dark) quencher compatible with a wide range of visible and near-infrared fluorophores (500-800 nm). It has the widest available quenching range, so you do not need to carefully match the donors fluorescence spectrum with the acceptors absorbance. IRDye QC-1 quenches common fluorophores with more than 97% efficiency1.	price>
R-C-5526	PLGA-TK-PEG-Biotin	PLGA refers to poly(lactic-co-glycolic acid), which is a biodegradable and biocompatible polymer commonly used in drug delivery systems. TK represents thymidine kinase, an enzyme involved in the metabolism of nucleosides. PEG stands for polyethylene glycol, a hydrophilic polymer that enhances the solubility and stability of the compound. Biotin is a vitamin that serves as a recognition moiety for binding to avidin or streptavidin, allowing for targeted delivery to cells expressing the avidin or streptavidin receptor.	price>
R-M2-9544	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG	DMG-PEG1000-YGMSPRNRTGSNKPNCIRAIWPTFTEPDG is a versatile molecule potentially applicable in various scientific and medical fields.It could be utilized for effective drug delivery, targeted therapy, or research into cell biology and interactions.	price>
R-C-7106	DSPE-PEG-iRGD-FITC	DSPE(1,2-distearoyl-sn-glycerin-3-phosphoethanolamine) As a hydrophobic fatty acid tail, it can be stably embedded in the hydrophobic layer of liposomes or nanocarriers, providing structural stability.PEG-iRGD-FITC is a hydrophilic head that is amphiphilic as a whole, making it easy to insert into the surface of liposomes or other nanocarriers and achieve stable membrane anchoring.	price>
R-M-7014	IRDye® 700 Phosphoramidite,cas:648882-22-8	IRDye 700 Phosphoramidite has been optimized for the 700 nm channel of the LI-COR 4300 DNA Analysis System.	price>
R-C-5527	DSPE-Se-Se-PEG-ADA	The presence of diselenide bonds in DSPE-Se-Se-PEG-ADA allows for its redox-responsive behavior. Under specific conditions,such as the presence of high levels of reducing agents,the diselenide bonds can be cleaved, leading to the release of the ADA enzyme from the liposomes.This property can be exploited to trigger the controlled release or activation of ADA in the targeted cells or tissues.	price>
R-M2-9545	Cholesterol-PEG2000-RVG29PPP(D-RVG29)	Cholesterol-PEG2000-RVG29PPP(D-RVG29) represents a promising strategy for targeted therapeutics, primarily in neurological contexts.The conjugate can encapsulate and deliver various therapeutic agents (small molecules, peptides, nucleic acids) directly to neuronal tissues. Given the ability of RVG29 to cross the blood-brain barrier, this conjugate could be used to treat neurodegenerative diseases (like Alzheimer’s or Parkinson’s disease) or CNS tumors.Can potentially be utilized to deliver genetic materials (such as siRNA or plasmids) into neural cells to address genetic disorders or modulate gene expression.Potential applications in neuroimaging or as a vector for imaging agents to enhance the detection of CNS disorders.	price>
R-M-7015	IRDye® 800 Phosphoramidite,cas:211380-08-4	IRDye 800 Phosphoramidite has been optimized for the 800 nm channel of the LI-COR 4300 DNA Analysis System.	price>
R-C-5528	Ytterbium 99.9% metals basis CAS：7440-64-4	Ytterbium (Yb) with a purity of 99.9% on a metals basis refers to a highly purified form of the element ytterbium. Ytterbium is a rare earth metal belonging to the lanthanide series of elements on the periodic table.	price>
R-M2-9546	DMG-PEG2000-RVG29PPP(D-RVG29)	The DMG-PEG2000-RVG29PPP(D-RVG29) construct represents a sophisticated approach to enhance drug delivery systems, particularly for targeting the central nervous system. The integration of DMG with PEG and RVG29 allows for improved solubility and specific targeting abilities, making this construct suitable for a wide range of therapeutic applications in CNS disorders. Potential use in imaging techniques for neurological conditions, acting as a vector for radiolabeled compounds or contrast agents to enhance visualization in medical imaging.	price>
R-C-7108	PBAE-TK-mPEG	mPEG-TK-PBAE,PBAE thioketal(TK)-mPEG(poly β-aminoester thione bond methoxypolyethylene glycol)is an intelligent drug carrier material that combines the biodegradability of poly β-aminoester,the oxidative stress response of thione bond,and the long cycling properties of methoxypolyethylene glycol.It is suitable for targeted therapy of tumors,treatment of inflammatory diseases,and gene delivery.	price>
R-C-5529	18:1 PDP PE CAS:474944-13-3 DOPE-SPDP	DOPE stands for 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine. It is a phospholipid commonly found in liposomes or lipid nanoparticles used for drug delivery. DOPE provides stability and fluidity to the lipid bilayer, facilitating the encapsulation and delivery of therapeutic agents.SPDP stands for N-succinimidyl 3-(2-pyridyldithio) propionate. It is a bifunctional cross-linking reagent used to link molecules together in bioconjugation reactions.	price>
R-M2-9547	Cholesterol-PEG-CD38(ARGDYYGSNSLDYW)	The Cholesterol-PEG-CD38(ARGDYYGSNSLDYW) construct represents a sophisticated approach for drug delivery, combining the cellular targeting capabilities of a peptide with the solubility-enhancing properties of PEG and the membrane fusion properties of cholesterol. Its design allows for specific applications in therapeutic and diagnostic fields, primarily within oncology and immunology.Cholesterol-PEG-CD38(ARGDYYGSNSLDYW)could be employed to deliver chemotherapeutic agents specifically to tumor cells expressing CD38, allowing for localized therapy with reduced systemic toxicity.It can be used in the formulation of vaccines where targeting immune cells is necessary to enhance vaccine efficacy.	price>
R-C-7109	PLGA-PEG-Taurine	Taurine-PEG-PLGA,PLGA-PEG-Taurine is a multifunctional biomaterial composed of poly(lactic acid glycolic acid)copolymer(PLGA),polyethylene glycol(PEG),and taurine.Its design combines degradability,hydrophilicity,and biological activity,and has important application value in the fields of drug delivery and tissue engineering.	price>

103310341035103610371038 10391040104110421043