Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M1-7098	1,2-Dimyristoyl-sn-glycerol-peg350-sialic acid	Sialic acid widely exists in animal tissues and is also distributed in a small amount in other organisms. It is mainly used as a component of glycoproteins and gangliosides.	price>
R-C-5615	COOH-SiO2@Fe3O4 12-17nm	Carboxyl functionalized mesoporous silica can form a composite material with iron (III) oxide (Fe3O4) to encapsulate Fe3O4 inside the mesoporous silica.Carboxyl modified mesoporous silica has a large pore structure and carboxyl functional groups, which can provide a good loading and surface modification platform. Fe3O4 is a magnetic material with potential applications in biomedical and magnetic materials fields.	price>
R-M2-9633	CHOL-PEG-CGHKAKGPRK	The CHOL-PEG-CGHKAKGPRK construct is a versatile building block for advanced therapeutic delivery systems. By leveraging the unique properties of each component, researchers can theoretically design drug delivery vehicles that are more effective and selective in treating diseases, particularly in oncology and potentially other areas such as gene therapy and vaccinations. If the peptide is known to bind to specific receptors (e.g., on tumor cells), the entire construct could be directed to deliver chemotherapeutics selectively to those cells. The construct could be part of a lipid nanoparticle or liposome designed to carry therapeutic agents, enhancing their stability and targeting. Similar constructs are used in vaccine formulations, where they can help present antigens effectively to the immune system. The peptide sequence may facilitate the endocytosis of the delivery vehicle into cells, making this construct suitable for delivering proteins, nucleic acids, or other therapeutic agents.	price>
R-C-7195	Mannose-Dextran sulfate sodium salt (DSS)	Mannose Dextran Sulfate Sodium Salt is a complex that combines mannose and dextran sulfate sodium salt(DSS).DSS is a polyanionic derivative of pectin with a molecular weight range of 36000 to 50000.Mannose is a monosaccharide that is commonly used as a ligand for targeted delivery or binding studies.	price>
R-M1-7099	sialic-acid-peg550-dmg	Sialic acid widely exists in animal tissues and is also distributed in a small amount in other organisms. It is mainly used as a component of glycoproteins and gangliosides.	price>
R-C-5616	DSPE-PEG4-Tetrazine	Tetrazine can be used for biorthogonal reactions in many bioimaging and conjugation applications.At present,it is widely used in protein specific site function interpretation,subcellular structure selective labeling,drug targeted delivery,in vivo animal molecular imaging and preparation of biocompatible materials.Polyethylene glycol phospholipid liposomes form high-quality materials, which can be used for drug delivery,gene transfection and vaccine delivery.	price>
R-M2-9634	DMG-PEG-CGHKAKGPRK	DMG-PEG-CGHKAKGPRK for tracking cellular processes, particularly if the peptide has affinity for specific cellular receptors. If the peptide sequence has biological activity (e.g., cell-penetrating capabilities, receptor agonism/antagonism), the construct could be part of a therapeutic regimen. Peptides like CGHKAKGPRK could be used in the development of vaccines, particularly if they can elicit an immune response. The construct can be used to coat nanoparticles, improving their biocompatibility and targeting mechanisms.	price>
R-C-7196	PLGA20000-F127-SH 50:50	PLGA20000-F127-SH is an amphiphilic block copolymer composed of polylactic acid hydroxyacetic acid copolymer(PLGA)and Pluronic F127,with thiol groups(-SH)at the ends. This material is commonly used in fields such as drug delivery and biocompatible materials.	price>
R-M1-8000	DMG-peg(mw600)-sialic acid	Sialic acid widely exists in animal tissues and is also distributed in a small amount in other organisms. It is mainly used as a component of glycoproteins and gangliosides.	price>
R-C-5617	Fe3O4 nanorods length:100~300nm,diameter:50nm	Fe3O4 nanorods have many important applications. Due to their magnetic and shape controllability, they can be used in fields such as magnetic separation, drug delivery, and magnetic resonance imaging. In addition, Fe3O4 nanorods can also be used to prepare new materials such as batteries, catalysts, sensors, etc.	price>
R-M2-9635	Simvastatin-TK-Heparin	The combination of Simvastatin, TK (if referring to thrombosis treatment), and Heparin could play a role in comprehensive care for patients at high risk for thrombotic events, particularly in acute scenarios. This would typically occur under close clinical supervision due to the complexities involved with anticoagulation and statin therapy. All products we provide are for scientific research purposes only and cannot be used for the human body.	price>
R-C-7197	DSPE-TK-PEG-M2pep	DSPE-TK-PEG-M2pep,DSPE provides the basis for liposome membrane structure,with ketothiol bonds that break in a reducing environment(such as high ROS in tumors), releasing PEG chains.PEG(polyethylene glycol) enhances water solubility,cycling stability, and targeting.M2pep(M2 macrophage-targeting peptide)is a linear peptide screened on M2 macrophages using phage display technology,with the sequence YEQDPWGVKWHY.	price>
R-M1-8001	DBCO-PEG350-FA	Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. DBCO-PEG-FA can go Click Chemistry reaction without a needof any catalysts.	price>
R-C-5618	PVIMDZQ-Osmium	PVIMDZQ-Osmium is characterized by the presence of imidazole and bipyridine ligands coordinated to the osmium(II) center.The quaternization of the N-vinyl imidazole groups enhances the water solubility and stability of the polymer complex.POLY(N-VINYL IMIDAZOLE, QUATERNIZED WITH BIS[2,2-BIPYRIDINE-N,N]-OSMIUM(II) COMPLEX) is a unique polymer complex with redox activity and light absorption properties. Its quaternization and coordination chemistry make it useful for diverse applications in areas like electrochemistry, catalysis, materials science, and bio-related research.	price>
R-M2-9636	NH2-TK-COOH	NH2-TK-COOH,NH2-Thioketal-COOH can serve as intermediates in various organic synthesis routes, particularly in the preparation of sulfur-containing compounds. Investigating thioketals for activity against specific biological targets, especially if they can be used to modify pharmacological agents. Thioketals might be used in the design of materials with specific electrical or optical properties or in polymer chemistry.	price>
R-C-7198	DSPE-PEG-CPLGLAGSRDIYSTDYYR(PEG-NH2)	DSPE-PEG-CPLGLAGSRDITDYYR is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CPLGLAGSRDITDYYR.Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,forming a structurally clear and functionally adjustable self-assembly system.	price>
R-M1-8002	DBCO-PEG550-Folic Acid	DBCO-PEG-FA can go Click Chemistry reaction without a needof any catalysts.Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.	price>
R-C-5619	POLY(N-VINYL IMIDAZOLE,QUATERNIZED WITH METHYL IODIDE)	POLY(N-VINYL IMIDAZOLE,QUATERNIZED WITH METHYL IODIDE)exhibits pH-responsive behavior, swelling and contracting in response to changes in pH.This property can be exploited in drug delivery systems to release encapsulated drugs or other molecular cargo on demand.PVMIm can also interact with biological molecules,such as DNA and proteins,due to its quaternary ammonium groups.This enables its use in applications like gene delivery, where the positively charged polymer can form complexes with negatively charged DNA,facilitating their cellular uptake.	price>
R-M2-9637	HS-PEG1000-TK-PEG1000-SH	HS-PEG1000-TK-PEG1000-SH is a versatile compound likely designed for applications in drug delivery and bioconjugation. This molecule can be utilized to stabilize nanoparticles in a biological environment, providing a protective coating that enhances biocompatibility.The thiol groups may be used in various chemical reactions, including crosslinking applications, to form hydrogels or other materials.The reactive thiol groups can be employed in the development of sensors, allowing for the detection of specific biomolecules through molecular interactions.	price>
R-C-7199	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH)	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions.	price>

104710481049105010511052 10531054105510561057