Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-M2-9637 | HS-PEG1000-TK-PEG1000-SH | HS-PEG1000-TK-PEG1000-SH is a versatile compound likely designed for applications in drug delivery and bioconjugation. This molecule can be utilized to stabilize nanoparticles in a biological environment, providing a protective coating that enhances biocompatibility.The thiol groups may be used in various chemical reactions, including crosslinking applications, to form hydrogels or other materials.The reactive thiol groups can be employed in the development of sensors, allowing for the detection of specific biomolecules through molecular interactions. | price> |
| R-C-7199 | DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) | DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions. | price> |
| R-M1-8003 | Dibenzocycolctyne-PEG750-Folic Acid | DBCO-PEG-FA can go Click Chemistry reaction without a needof any catalysts.Applicated in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. | price> |
| R-C-5620 | DSPE-PCB | DSPE-PCB20 had the same ability to enhance the serum stability of lipoplexes. However, quite different from the PEGylation, zwitterionic DSPE-PCB20 could offer stability without interfering with the siRNA encapsulation efficiency and endosomal/lysosomal escape ability of lipoplexes, which was favorable for the systemic delivery of siRNA. | price> |
| R-M2-9638 | Adamantane-PAA modified core-shell upconversion nanoparticles NaYF4:Yb,Er@NaYF4:Nd,Yb@NaYF4 | ADA-PAA modified core-shell upconversion nanoparticles NaYF4:Yb,Er@NaYF4:Nd,Yb@NaYF4 (808 excitation, green light) describes a sophisticated nanostructure designed for enhanced luminescent properties, for advanced imaging, phototherapy, or sensing applications. The unique properties of the adamantane and PAA modifications, along with the core-shell architecture, play pivotal roles in improving the stability and functionality of these nanomaterials. | price> |
| R-C-7200 | DMPE-PEG-KYIKFKHDYNILEFNDGTFE-K-FI | DMPE is a phospholipid molecule containing myristoyl and phosphatidylcholine.The hydrophobic chain of DMPE facilitates its embedding in biological membranes or liposomes,enhancing the binding between molecules and membranes.PEG is a hydrophilic polymer used to increase the water solubility and biocompatibility of molecules.PEG has good flexibility,which can improve the solubility and stability of molecules,and reduce non-specific binding.It can couple various peptides(KYIKFKHDYNILEFNDGTFE-K-FI) and small molecule groups. | price> |
| R-M1-8004 | Methyltetrazine-NHS Ester,Cas:1644644-96-1 | Methyltetrazine-NHS ester is a linker for bio-conjugation that contains a methyltetrazine group and a terminal NHS ester group. | price> |
| R-C-5621 | DSPE-PEG2000-TFFYGGSRGKRNNFKTEEY | The peptide sequence Angiopep-2 (TFFYGGSRGKRNNFKTEEYC) is a specific targeting peptide derived from the protein fibronectin. This peptide is known to have affinity for certain receptors or molecules present on the surface of specific cell types. By conjugating this peptide to DSPE-PEG2000, the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells. | price> |
| R-M2-9639 | Adamantane-BSA | Adamantane-BSA,Adamantane-bovine serum albumin represents a versatile conjugate with significant implications in drug delivery, targeting, imaging, and other therapeutic applications. Adamantane can be used for bioconjugation with targeting ligands (e.g., antibodies or peptides) to direct BSA to specific tissues or cells, enhancing drug delivery mechanisms. The Adamantane-BSA conjugate can serve as a stabilizing agent or template for the synthesis of nanoparticles or other nano-carriers, improving the stability and functionality of drug delivery systems. | price> |
| R-C-7201 | DSPE-TK-PEG-CSTSMLKAC | DSPE-TK-PEG-CTSSMLKAC is a ROS responsive nanomaterial that combines phospholipids,polyethylene glycol(PEG),and cardiac targeting peptides(CSTSMLKAC).It has targeted delivery and controlled release functions and is mainly used in the treatment of myocardial diseases or drug delivery systems Thioketal is a ROS responsive linker that can be cleaved in high reactive oxygen species(ROS)environments,enabling controlled drug release. | price> |
| R-M1-8005 | Tetrazine NHS Ester,CAS:1616668-55-3 | Tetrazine-NHS Ester demonstrates exceptionally fast cycloaddition kinetics (up to 30 000 M-1 s-1) with trans-cyclooctene (TCO) as the dienophile, the fastest kinetics ever reported for any bioorthogonal reaction. The chemical stability tetrazines is substantially lower compared to Methyltetrazines, which requires more careful selection of reagents and conditions for chemical transformation, however it is in acceptable range for many applications. This product is not recommended for labeling of proteins or any other biopolymers in aqueous buffers due to poor aqueous solubility. | price> |
| R-C-5622 | DSPE-PEG2000-CLSSRLDAC | DSPE(1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a phospholipid that can integrate into the lipid bilayer of liposomes or nanoparticles.PEG2000 refers to the attachment of a polyethylene glycol (PEG) polymer chain of approximately 2000 Daltons in size,providing stealth properties to the formulation and increasing its circulation time in the bloodstream.The peptide sequence CLSSRLDAC is a specific targeting peptide with affinity for certain receptors or molecules present on the surface of specific cells.By conjugating this peptide to DSPE-PEG2000,the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells. | price> |
| R-M2-9640 | Adamantane-PEG4-NHS | Adamantane-PEG4-NHS is a powerful and versatile chemical compound suitable for various bioengineering, drug delivery, and research applications. Its combination of a hydrophobic adamantane core, a hydrophilic PEG chain, and a reactive NHS group makes it ideal for creating stable and effective bioconjugates. | price> |
| R-C-7202 | DPPS-PEG-NTA-Ni | NTA-Ni-PEG-DPPS,DPPS-PEG-NTA-Ni is a phospholipid polyethylene glycol nickel column derivative.DPPS has a hydrophilic phosphoserine head and two hydrophobic fatty acid tails,which enable it to spontaneously form phospholipid bilayers in aqueous solution. NTA is a metal ion chelating ligand that is particularly suitable for forming stable complexes with nickel ions(Ni). | price> |
| R-M1-8006 | Propargyl-NHS Ester,cas:1174157-65-3 | Propargyl-NHS Ester is a simple alkyne-containing reagent that reacts with primary amines at pH 7-9 forming a stale amide bond. The terminal alkyne group reacts with azides by a mechanism known as the Cu-catalyzed click reaction enabling efficient and specific conjugation of derivatized molecules in biological samples. A short spacer arm adds minimal mass to modified molecules. | price> |
| R-C-5623 | DSPE-PEG2000-CLPVASC | DSPE-PEG-CLPVASC,The hydrophobic anchoring part is also based on the DSPE skeleton; The intermediate connecting unit is a polyethylene glycol (PEG) segment; Terminal coupled CLPVASC peptide segment, which has specific recognition function; The overall molecular weight varies with PEG length and peptide composition, commonly ranging from 3000-6000 Da; it can self assemble into micelles or embed into lipid bilayer structures in buffered aqueous solutions. | price> |
| R-M2-9641 | Tannic acid-TK-Polypropylene glycol 1K-TK-Adamantane | Tannic acid-TK-Polypropylene glycol 1K-TK-Adamantane could be applied in food packaging or biomedical devices to provide anti-inflammatory, antioxidant, or antimicrobial properties through the tannic acid component. These components together could form nanoparticles or micelles that enhance drug solubility and biocompatibility, enabling targeted therapy strategies. | price> |
| R-C-7203 | DLPE-PEG-NTA-Ni | NTA-Ni-PEG-DLPE,1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine(DLPE)is an important phospholipid compound.As a component analog of cell membranes,it can be used to construct artificial liposomes,simulate the properties and functions of biological membranes,and help study the interactions between membrane proteins and membranes.NTA is a metal ion chelating ligand that is particularly suitable for forming stable complexes with nickel ions(Ni). | price> |
| R-M1-8007 | mPEG2000-C6H6-CHO | MPEG2000-C6H6-CHO is a heterogeneous and bifunctional peg reagent. | price> |
| R-C-5624 | DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP | DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP,(DSPE) polyethyleneglycol is a combination of phospholipid and polyethylene glycol,which has hydrophilicity and hydrophobicity.Polyethylene glycol liposomes were used to form high-quality materials.It can be used for drug delivery,gene transfection and vaccine delivery.We can also customize various products with different molecular weights. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


