Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-M1-8158 | DOTA-Er | DOTA-Er is a chelating agent.Dota is a twelve membered tetraazamacrocyclic ligand.Kamulin biology has its own laboratory and technical personnel;professional metal ions, development of macrocyclic ligands and their use as MRI contrast agents; including a series of products such as bifunctional chelating agents, macrocyclic ligands, magnetic resonance reagents, reaction intermediates, etc. | price> |
| R-C-5775 | PEG-P(DEA39-DPA61) | PEG-PDEA-PDPA,PDEA and PDPA are pH-responsive polymers that can undergo changes in their conformation and properties in response to changes in pH. These polymers are typically cationic at a low pH (such as in an acidic environment), making them suitable for drug delivery applications in acidic environments like tumors or intracellular compartments. | price> |
| R-M2-9793 | Propargyl-PEG2k-CSTSMLKAC | Propargyl-PEG2k-CSTSMLKAC is a molecule composed of a propargyl group, a PEG2000 linker, and the peptide CSTSMLKAC. The propargyl group can be used for copper-catalyzed azide-alkyne cycloaddition (CuAAC) click chemistry. The peptide CSTSMLKAC has been identified as a targeting sequence for ischemic heart tissue. PEGylation with PEG2000 enhances water solubility and biocompatibility. | price> |
| R-M1-8159 | CS-TPP-siRNA nanoparticles | CS TPP siRNA nanoparticles, Chitosan triphosphate siRNA nanoparticles are nanocomposites that can be used for protein imprinting analysis research. | price> |
| R-C-5776 | PS6500-b-PEG4000-COOH | PS-b-PEG-COOH,Polystyrene(PS)is a kind of polymer synthesized by free radical addition reaction of styrene monomer,and polyethylene glycol(PEG)is an oligomer or polymer of ethylene oxide.The product is non-toxic,non irritant,slightly bitter in taste,good in water solubility and good in compatibility with many organic components.This product is only used for scientific research experiments and is not intended for clinical human use. | price> |
| R-M2-9794 | CSTSMLKAC | CSTSMLKAC is a validated ischemic myocardium-targeting peptide, widely used in cardiac nanomedicine, miRNA/exosome therapy, and targeted imaging.It enables precise delivery to post-infarction cardiac tissue, increasing therapeutic index and minimizing systemic toxicity. | price> |
| R-M2-9795 | MTX-PEG3-tryptosol | Methotrexate-PEG3-Tryptosol is a multifunctional drug conjugate.Methotrexate (MTX): A chemotherapeutic agent that inhibits dihydrofolate reductase (DHFR), commonly used in cancer therapy and autoimmune disease treatment.PEG₃ (Triethylene Glycol): A short hydrophilic linker that improves solubility, flexibility, and blood circulation time.Tryptosol (likely Tryptophol or a tryptophan derivative): An indole-containing molecule that may aid in membrane permeability, enzymatic responsiveness, or self-assembly. | price> |
| R-M1-8160 | [Azo][BF4] | [Azo] [BF4] has a water solubility of up to 5 wt.% and excellent thermal stability (269 ° C). [Azo] [BF4] exhibits rapid reversible isomerization in water, achieving trans cis isomerization under ultraviolet light (365 nm) for 24 seconds, and cis trans isomerization under visible light treatment for 27 seconds. The molar ratios of cis isomers under ultraviolet and visible light irradiation are 60% and 9%, respectively. It has potential applications in soft optical appliances and bionics, providing updated concepts for artificial intelligence material systems. | price> |
| R-C-5777 | PDMA2K-PLGA5K | PLGA-b-PDMA,PDMA-PLGA,PLGA-b-PDMA because PDMA by itself is a potent polycation used in nonviral gene delivery,and PLGA provides the hydrophobic core to form cNP.The binding of NA to cNP stems from charge interaction and we could optimize the NA-scavenging performance of the cNP by varying the molecular weight of PDMA.This product is only used for scientific research experiments and is not intended for clinical human use. | price> |
| R-M1-8161 | RCC3 | RCC3 is a Porous organic cages (POCs) material.The RCC3 porous organic cage displayed a pore size of approximately 5.4 Å and a high specific surface area of 442.3 m2 g−1, which provided amine-rich subnanochannels for the rapid penetration of CO2. The excellent separation performance provided a more economical solution for CO2 capture from flue gas or natural gas purification.Meanwhile, the unique structure of RCC3 (molecular-level size, organic framework and rich –NH– groups) helps to achieve molecular-level mixing between polymer chains and individual caged molecules in the membrane, thus overcoming the problem of interfacial defects. Furthermore, the membrane possessed excellent long-term stability, which underlined the promising potential in practical application. | price> |
| R-C-5778 | DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT | DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. | price> |
| R-M2-9796 | Biotin-PEG3-Artesunate | Biotin-PEG3-Artesunate is a targeted drug conjugate designed to enhance the delivery, solubility, and selectivity of artesunate-a potent antimalarial and anticancer agent. | price> |
| R-M1-8162 | Octadecyl-peg2k-sulphate | Octadecyl-peg2k-sulphate,Octadecyl polyethylene glycol sulphate/sulfate(ion) It is a bifunctional peg reagent. | price> |
| R-C-5779 | Mesoporous silica encapsulated drug (Requinmod) 50NM | Mesoporous silica is a highly structured and ordered nanomaterial with a large number of pores and a high specific surface area. The encapsulation of Risedronate into 50 nanometer sized mesoporous silica can achieve efficient drug transport and controlled release. Mesoporous silica can also provide a certain protective effect to prevent the decomposition and deactivation of drugs. | price> |
| R-M2-9797 | DMG-PEG3.4K-HHLGGAKQAGDV | DMG-PEG3.4K-HHLGGAKQAGDV is a stealthy, lipid-anchored, integrin-targeting peptide conjugate, well-suited for applications in Cardiovascular drug delivery,Inflammation-targeted nanocarriers,Liposome surface functionalization,Thrombus imaging or therapy. | price> |
| R-M1-8163 | 3,3-Dioctyl-2,25,2-terthiophene,CAS:155166-89-5 | 3,3-Dioctyl-2,2 5,2-terthiophene (DOT) is a novel organic compound with potential applications in a variety of fields. It is a polycyclic aromatic hydrocarbon (PAH) that has a planar, aromatic structure and a wide range of physical and chemical properties. DOT is a highly versatile compound, and its unique properties make it an attractive candidate for a variety of applications in materials science, pharmaceuticals, and biochemistry. | price> |
| R-C-5780 | Ag2Te QDs (Oil phase) transmit:1500 | Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution.transmit:1500 | price> |
| R-M2-9798 | Chol-PEG3.4K-HHLGGAKQAGDV | Cholesterol-PEG3.4K-HHLGGAKQAGDV is a rationally engineered molecule designed to: Embed into lipid-based nanoparticles; Present an integrin-targeting peptide (especially for platelet or vascular targeting); Enable fluorescence imaging, drug delivery, or antithrombotic treatment. | price> |
| R-M1-8164 | Ni-NTA-Nano gold,10 nm | Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting. | price> |
| R-C-5781 | Ag2Te QDs (aqueous phase) transmit:1500 | Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


