Home > Keywords > 
Catalog name Description price
R-M2-9794 CSTSMLKAC CSTSMLKAC is a validated ischemic myocardium-targeting peptide, widely used in cardiac nanomedicine, miRNA/exosome therapy, and targeted imaging.It enables precise delivery to post-infarction cardiac tissue, increasing therapeutic index and minimizing systemic toxicity. price>
R-C-7356 PLGA-PEG-L-Ser DSPE-PEG-L-Ser is a functional phospholipid derivative designed specifically for the construction of micelles and liposomes.It uses distearoyl phosphatidylethanolamine (DSPE)as the hydrophobic core unit and polyethylene glycol(PEG)as the hydrophilic modification arm,covalently linking L-serine(L-ser).It combines amphiphilicity, biocompatibility, carrier stability, and functional expandability. price>
R-M2-9795 MTX-PEG3-tryptosol Methotrexate-PEG3-Tryptosol is a multifunctional drug conjugate.Methotrexate (MTX): A chemotherapeutic agent that inhibits dihydrofolate reductase (DHFR), commonly used in cancer therapy and autoimmune disease treatment.PEG₃ (Triethylene Glycol): A short hydrophilic linker that improves solubility, flexibility, and blood circulation time.Tryptosol (likely Tryptophol or a tryptophan derivative): An indole-containing molecule that may aid in membrane permeability, enzymatic responsiveness, or self-assembly. price>
R-M1-8160 [Azo][BF4] [Azo] [BF4] has a water solubility of up to 5 wt.% and excellent thermal stability (269 ° C). [Azo] [BF4] exhibits rapid reversible isomerization in water, achieving trans cis isomerization under ultraviolet light (365 nm) for 24 seconds, and cis trans isomerization under visible light treatment for 27 seconds. The molar ratios of cis isomers under ultraviolet and visible light irradiation are 60% and 9%, respectively. It has potential applications in soft optical appliances and bionics, providing updated concepts for artificial intelligence material systems. price>
R-C-5777 PDMA2K-PLGA5K PLGA-b-PDMA,PDMA-PLGA,PLGA-b-PDMA because PDMA by itself is a potent polycation used in nonviral gene delivery,and PLGA provides the hydrophobic core to form cNP.The binding of NA to cNP stems from charge interaction and we could optimize the NA-scavenging performance of the cNP by varying the molecular weight of PDMA.This product is only used for scientific research experiments and is not intended for clinical human use. price>
R-C-7357 DSPE-PEG-D-Ser D-Ser-PEG-DSPE,DSPE-PEG-D-Ser is a composite molecule composed of phospholipids,polyethylene glycol(PEG),and D-serine,belonging to the functional materials in the field of biochemistry. Its core structure combines the hydrophobicity of phospholipids with the hydrophilicity of PEG through chemical modification,and introduces biologically active D-serine to form a molecular complex that combines stability and functionality. price>
R-M1-8161 RCC3 RCC3 is a Porous organic cages (POCs) material.The RCC3 porous organic cage displayed a pore size of approximately 5.4 Å and a high specific surface area of 442.3 m2 g−1, which provided amine-rich subnanochannels for the rapid penetration of CO2. The excellent separation performance provided a more economical solution for CO2 capture from flue gas or natural gas purification.Meanwhile, the unique structure of RCC3 (molecular-level size, organic framework and rich –NH– groups) helps to achieve molecular-level mixing between polymer chains and individual caged molecules in the membrane, thus overcoming the problem of interfacial defects. Furthermore, the membrane possessed excellent long-term stability, which underlined the promising potential in practical application. price>
R-C-5778 DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. price>
R-M2-9796 Biotin-PEG3-Artesunate Biotin-PEG3-Artesunate is a targeted drug conjugate designed to enhance the delivery, solubility, and selectivity of artesunate-a potent antimalarial and anticancer agent. price>
R-C-7358 DPPS-CY3 CY3-DPPS,DPPS-Cyanine3,CY3-DPPS is a type of research molecule that combines fluorescence properties and phospholipid functionality. Cy3-DPPS is a derivative in which the fluorescent dye Cy3 is covalently modified onto DPPS molecules. It not only maintains the membrane affinity of phospholipid molecules, but also imparts a clear fluorescence signal, making it a visual probe that can be applied in various research systems. price>
R-M1-8162 Octadecyl-peg2k-sulphate Octadecyl-peg2k-sulphate,Octadecyl polyethylene glycol sulphate/sulfate(ion) It is a bifunctional peg reagent. price>
R-C-5779 Mesoporous silica encapsulated drug (Requinmod) 50NM Mesoporous silica is a highly structured and ordered nanomaterial with a large number of pores and a high specific surface area. The encapsulation of Risedronate into 50 nanometer sized mesoporous silica can achieve efficient drug transport and controlled release. Mesoporous silica can also provide a certain protective effect to prevent the decomposition and deactivation of drugs. price>
R-M2-9797 DMG-PEG3.4K-HHLGGAKQAGDV DMG-PEG3.4K-HHLGGAKQAGDV is a stealthy, lipid-anchored, integrin-targeting peptide conjugate, well-suited for applications in Cardiovascular drug delivery,Inflammation-targeted nanocarriers,Liposome surface functionalization,Thrombus imaging or therapy. price>
R-C-7359 SLinPS CAS:322647-11-0 SLinPS (1-stearoyl-2-oleoylphosphatidylserine sodium salt,CAS:322647-11-0)is a natural phospholipid acid derivative composed of a saturated stearoyl chain(C18:0),an unsaturated oleoyl chain(C18:2, omega-6),and a serine phospholipid head group.Its sodium salt form endows it with water solubility and ionic stability,allowing it to form a stable negatively charged lipid bilayer structure in aqueous systems. price>
R-M1-8163 3,3-Dioctyl-2,25,2-terthiophene,CAS:155166-89-5 3,3-Dioctyl-2,2 5,2-terthiophene (DOT) is a novel organic compound with potential applications in a variety of fields. It is a polycyclic aromatic hydrocarbon (PAH) that has a planar, aromatic structure and a wide range of physical and chemical properties. DOT is a highly versatile compound, and its unique properties make it an attractive candidate for a variety of applications in materials science, pharmaceuticals, and biochemistry. price>
R-C-5780 Ag2Te QDs (Oil phase) transmit:1500 Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution.transmit:1500 price>
R-M2-9798 Chol-PEG3.4K-HHLGGAKQAGDV Cholesterol-PEG3.4K-HHLGGAKQAGDV is a rationally engineered molecule designed to: Embed into lipid-based nanoparticles; Present an integrin-targeting peptide (especially for platelet or vascular targeting); Enable fluorescence imaging, drug delivery, or antithrombotic treatment. price>
R-C-7360 DMPS-Na CAS:105405-50-3 DMPS Na(CAS:105405-50-3)is a synthetic anionic phospholipid,also known as 1,2-dimyristoyl-sn-glycero-3-phospho-L-serine (sodium salt),widely used in fields such as biofilm research, drug delivery systems, and exploration of cellular functional mechanisms. price>
R-M1-8164 Ni-NTA-Nano gold,10 nm Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting. price>
R-C-5781 Ag2Te QDs (aqueous phase) transmit:1500 Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution. price>