Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-C-7354 | DSPE-SS-PEG-Serine | DSPE-SS-PEG2k-Serine,The hydrophobic double chain of DSPE can be embedded into the core of liposomes or nanoparticles,while PEG provides a hydrophilic shell,allowing the entire molecule to spontaneously form stable micelle or liposome structures in the aqueous phase.The disulfide bond(SS)in the middle can be broken in the reducing environment of high concentration glutathione(GSH)in cells,achieving targeted drug release in tumor cells,improving treatment efficiency and reducing systemic toxicity. Serine contains -OH and -NH2 functional groups at the end,which exhibit excellent chemical reactivity and can be used for further coupling of targeted molecules. | price> |
| R-M1-8158 | DOTA-Er | DOTA-Er is a chelating agent.Dota is a twelve membered tetraazamacrocyclic ligand.Kamulin biology has its own laboratory and technical personnel;professional metal ions, development of macrocyclic ligands and their use as MRI contrast agents; including a series of products such as bifunctional chelating agents, macrocyclic ligands, magnetic resonance reagents, reaction intermediates, etc. | price> |
| R-C-5775 | PEG-P(DEA39-DPA61) | PEG-PDEA-PDPA,PDEA and PDPA are pH-responsive polymers that can undergo changes in their conformation and properties in response to changes in pH. These polymers are typically cationic at a low pH (such as in an acidic environment), making them suitable for drug delivery applications in acidic environments like tumors or intracellular compartments. | price> |
| R-M2-9793 | Propargyl-PEG2k-CSTSMLKAC | Propargyl-PEG2k-CSTSMLKAC is a molecule composed of a propargyl group, a PEG2000 linker, and the peptide CSTSMLKAC. The propargyl group can be used for copper-catalyzed azide-alkyne cycloaddition (CuAAC) click chemistry. The peptide CSTSMLKAC has been identified as a targeting sequence for ischemic heart tissue. PEGylation with PEG2000 enhances water solubility and biocompatibility. | price> |
| R-C-7355 | PLGA-HYD-PEG-PS | PS-PEG-HYD-PLGA,PLGA is a biodegradable polymer formed by copolymerization of lactic acid(LA)and glycolic acid(GA),which is hydrolyzed in vivo to produce metabolites such as lactic acid and glycolic acid.The Hyd linking group can be cleaved under acidic or enzymatic conditions to achieve intelligent release and structural response.PEG provides a hydrophilic outer layer,increasing the stability of nanoparticles in aqueous phase. Phosphatidylserine(PS)a naturally occurring anionic phospholipid,typically located in the lobules of the cell membrane,that turns outward during apoptosis and can be recognized by macrophages or certain receptors. | price> |
| R-M1-8159 | CS-TPP-siRNA nanoparticles | CS TPP siRNA nanoparticles, Chitosan triphosphate siRNA nanoparticles are nanocomposites that can be used for protein imprinting analysis research. | price> |
| R-C-5776 | PS6500-b-PEG4000-COOH | PS-b-PEG-COOH,Polystyrene(PS)is a kind of polymer synthesized by free radical addition reaction of styrene monomer,and polyethylene glycol(PEG)is an oligomer or polymer of ethylene oxide.The product is non-toxic,non irritant,slightly bitter in taste,good in water solubility and good in compatibility with many organic components.This product is only used for scientific research experiments and is not intended for clinical human use. | price> |
| R-M2-9794 | CSTSMLKAC | CSTSMLKAC is a validated ischemic myocardium-targeting peptide, widely used in cardiac nanomedicine, miRNA/exosome therapy, and targeted imaging.It enables precise delivery to post-infarction cardiac tissue, increasing therapeutic index and minimizing systemic toxicity. | price> |
| R-C-7356 | PLGA-PEG-L-Ser | DSPE-PEG-L-Ser is a functional phospholipid derivative designed specifically for the construction of micelles and liposomes.It uses distearoyl phosphatidylethanolamine (DSPE)as the hydrophobic core unit and polyethylene glycol(PEG)as the hydrophilic modification arm,covalently linking L-serine(L-ser).It combines amphiphilicity, biocompatibility, carrier stability, and functional expandability. | price> |
| R-M2-9795 | MTX-PEG3-tryptosol | Methotrexate-PEG3-Tryptosol is a multifunctional drug conjugate.Methotrexate (MTX): A chemotherapeutic agent that inhibits dihydrofolate reductase (DHFR), commonly used in cancer therapy and autoimmune disease treatment.PEG₃ (Triethylene Glycol): A short hydrophilic linker that improves solubility, flexibility, and blood circulation time.Tryptosol (likely Tryptophol or a tryptophan derivative): An indole-containing molecule that may aid in membrane permeability, enzymatic responsiveness, or self-assembly. | price> |
| R-M1-8160 | [Azo][BF4] | [Azo] [BF4] has a water solubility of up to 5 wt.% and excellent thermal stability (269 ° C). [Azo] [BF4] exhibits rapid reversible isomerization in water, achieving trans cis isomerization under ultraviolet light (365 nm) for 24 seconds, and cis trans isomerization under visible light treatment for 27 seconds. The molar ratios of cis isomers under ultraviolet and visible light irradiation are 60% and 9%, respectively. It has potential applications in soft optical appliances and bionics, providing updated concepts for artificial intelligence material systems. | price> |
| R-C-5777 | PDMA2K-PLGA5K | PLGA-b-PDMA,PDMA-PLGA,PLGA-b-PDMA because PDMA by itself is a potent polycation used in nonviral gene delivery,and PLGA provides the hydrophobic core to form cNP.The binding of NA to cNP stems from charge interaction and we could optimize the NA-scavenging performance of the cNP by varying the molecular weight of PDMA.This product is only used for scientific research experiments and is not intended for clinical human use. | price> |
| R-C-7357 | DSPE-PEG-D-Ser | D-Ser-PEG-DSPE,DSPE-PEG-D-Ser is a composite molecule composed of phospholipids,polyethylene glycol(PEG),and D-serine,belonging to the functional materials in the field of biochemistry. Its core structure combines the hydrophobicity of phospholipids with the hydrophilicity of PEG through chemical modification,and introduces biologically active D-serine to form a molecular complex that combines stability and functionality. | price> |
| R-M1-8161 | RCC3 | RCC3 is a Porous organic cages (POCs) material.The RCC3 porous organic cage displayed a pore size of approximately 5.4 Å and a high specific surface area of 442.3 m2 g−1, which provided amine-rich subnanochannels for the rapid penetration of CO2. The excellent separation performance provided a more economical solution for CO2 capture from flue gas or natural gas purification.Meanwhile, the unique structure of RCC3 (molecular-level size, organic framework and rich –NH– groups) helps to achieve molecular-level mixing between polymer chains and individual caged molecules in the membrane, thus overcoming the problem of interfacial defects. Furthermore, the membrane possessed excellent long-term stability, which underlined the promising potential in practical application. | price> |
| R-C-5778 | DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT | DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. | price> |
| R-M2-9796 | Biotin-PEG3-Artesunate | Biotin-PEG3-Artesunate is a targeted drug conjugate designed to enhance the delivery, solubility, and selectivity of artesunate-a potent antimalarial and anticancer agent. | price> |
| R-C-7358 | DPPS-CY3 | CY3-DPPS,DPPS-Cyanine3,CY3-DPPS is a type of research molecule that combines fluorescence properties and phospholipid functionality. Cy3-DPPS is a derivative in which the fluorescent dye Cy3 is covalently modified onto DPPS molecules. It not only maintains the membrane affinity of phospholipid molecules, but also imparts a clear fluorescence signal, making it a visual probe that can be applied in various research systems. | price> |
| R-M1-8162 | Octadecyl-peg2k-sulphate | Octadecyl-peg2k-sulphate,Octadecyl polyethylene glycol sulphate/sulfate(ion) It is a bifunctional peg reagent. | price> |
| R-C-5779 | Mesoporous silica encapsulated drug (Requinmod) 50NM | Mesoporous silica is a highly structured and ordered nanomaterial with a large number of pores and a high specific surface area. The encapsulation of Risedronate into 50 nanometer sized mesoporous silica can achieve efficient drug transport and controlled release. Mesoporous silica can also provide a certain protective effect to prevent the decomposition and deactivation of drugs. | price> |
| R-M2-9797 | DMG-PEG3.4K-HHLGGAKQAGDV | DMG-PEG3.4K-HHLGGAKQAGDV is a stealthy, lipid-anchored, integrin-targeting peptide conjugate, well-suited for applications in Cardiovascular drug delivery,Inflammation-targeted nanocarriers,Liposome surface functionalization,Thrombus imaging or therapy. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


