Home > Keywords >
Catalog | name | Description | price |
---|---|---|---|
R-M1-8607 | Cy5.5 PEG amine | CY5.5-PEG-NH2/Cyanine 5.5 PEG amine/Amine-peg-Cy5.5/NH2-PEG-CY5.5 can be used in various applications such as molecular imaging, drug delivery, or bioconjugation. The PEG2K chain can help improve the stability, solubility, and in vivo circulation time of the labeled compounds. The amino group provides a site for further modification or conjugation to other molecules, proteins, or surfaces, allowing for specific targeting or functionalization based on the specific application requirements. | price> |
R-C-6225 | POLY(2-ACRYLAMIDO-2-METHYLPROPANE SULFONIC ACID) CAS:27119-07-9 | Poly(2-acrylamido-2-methylpropanesulfonic acid) is synthesized by RAFT polymerization of acrylamido sulsonic acid monomer using 4,4-azo(4-cyanopentanoic acid) as initiator and trithiocarbonate as chain transfer agent in water. | price> |
R-M1-8608 | Maleimido-mono-amide-DOTA | Maleimido-mono-amide-DOTA is a non-cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs). | price> |
R-C-6226 | POLY(N-PHENETHYL METHACRYLAMIDE) | Poly(N-phenethyl methacrylamide),or PPEMA,is a type of synthetic polymer that is derived from the monomer N-phenethyl methacrylamide.It offers promise in applications such as targeted drug delivery and sustained-release formulations.The biocompatibility and tunable properties of PPEMA make it an attractive material for various biomedical applications. | price> |
R-M1-8609 | CCK-8 test kit | Cell Counting Kit-8/Cell Counting Kit-8 (CCK-8)/CCK8 test kit/Cell Counting Kit-8 (CCK-8)/Cell Counting Kit-8, also known as CCK-8 kit, is a fast and highly sensitive kit based on WST-8 that is widely used for cell activity and cytotoxicity detection. WST-8 is an upgraded product of MTT, and its working principle is that in the presence of electron coupling reagents, it can be reduced by dehydrogenase in mitochondria to produce highly water-soluble orange yellow formazan products. The depth of color is directly proportional to cell proliferation and inversely proportional to cytotoxicity. Using an enzyme-linked immunosorbent assay (ELISA) to measure the OD value at a wavelength of 450nm indirectly reflects the number of living cells. The CCK-8 method is widely used, such as drug screening, cell proliferation assay, cytotoxicity assay, tumor drug sensitivity test, and biological factor activity detection. Stored at 4°C protecting from light, and is stable for up to 12 months. Stored at -20°C protecting from light, and is stable for up to 2 years. | price> |
R-C-6227 | POLY(N,N-DIMETHYLAMINOPROPYL ACRYLAMIDE) | Poly(N,N-dimethylaminopropyl acrylamide)(PDMAAm) is a type of synthetic polymer that offers a wide range of applications due to its unique properties.This polymer is known for its thermo-responsive behavior, which means it can undergo reversible solubility transitions in response to changes in temperature,particularly around its lower critical solution temperature (LCST). | price> |
R-M1-8610 | BCN-PEG4-FITC | A linker-modified FITC molecule containing a cyclooctyne group (BCN-PEG4-FITC/BCN-PEG4-Fluorescein isothiocyanate/BCN-PEG4-Fluorescein isothiocyanate-PEG4-BCN) was attached via “Click’’reaction. | price> |
R-C-6228 | POLY(N,N-DIMETHYL ACRYLAMIDE) CAS:26793-34-0 | Poly(N,N-dimethyl acrylamide)(PDMA)is a synthetic polymer that belongs to the class of polyacrylamides.PDMA is widely studied for its potential applications in drug delivery systems,tissue engineering, and as a biomaterial due to its biocompatibility and unique thermal responsiveness. | price> |
R-M1-8611 | CY5@LNP-RGD(100nm) | CY5@Lipid Nanoparticles-RGD(100nm)/CY5@LNP-RGD(100nm)/CY5@RGD-Modified Lipid Nanoparticles(100nm)/Cyanine5@RGD-Modified Lipid Nanoparticles containing a novel pH-sensitive and biodegradable lipid Nanoparticles. It can be used for targeted drug delivery and cancer research. | price> |
R-C-6229 | POLY(2-ACRYLAMIDO-2-METHYLPROPANESULFONIC ACID SODIUM SALT) | Synonym: Poly(sodium 2-acrylamido-2-methyl-propanesulfonate).Poly(2-acrylamido-2-methylpropanesulfonic acid sodium salt) or Poly(AMPS)is a synthetic polymer that contains sulfonic acid groups.Due to the presence of sulfonic acid groups,Poly(AMPS)is also utilized as an ion-exchange resin to remove heavy metal ions and other impurities from water.Moreover, its high thermal stability makes it suitable for use in high-temperature applications. | price> |
R-M1-8612 | CY5@LNP(100nm) | Cyanine5@LNP(100nm)/CY5@LNP(100nm) /CY5@liposome nanoparticles(100nm) /Cyanine5@liposome nanoparticles(100nm) containing a novel pH-sensitive and biodegradable lipid Nanoparticles. It can be used for targeted drug delivery and cancer research. | price> |
R-C-6230 | POLY(ACRYLAMIDE) CAS:9003-05-8 | Poly(acrylamide) is a synthetic polymer that is widely used in various industrial and scientific applications.One of the main applications of poly(acrylamide)is as a flocculant in water treatment processes. It is used to remove solids and impurities from water by causing particles to clump together and settle out, making it easier to separate them from the water. | price> |
R-M1-8613 | D-α-tocopheryl polyethylene glycol succinate-NHS | D-α-tocopheryl polyethylene glycol succinate-NHS/TPGS-NHS/d-α-tocopheryl polyethylene glycol succinate (TPGS)-NHS/d-α-tocopheryl polyethylene glycol succinate N-hydroxylsuccinimide/TPGS-N-hydroxylsuccinimide can as a potential carrier for controlled delivery of the drug.TPGS can target the mitochondria of cancer cells and leads to their destruction by activating mitochondrial apoptosis mediators This anticancer activity has been shown against cancer cells only and does not affect healthy cells TPGS has been explored in combination therapy with many anticancer drugs, including DOX-loaded nanocarriers. | price> |
R-C-6231 | POLY(ISOPROPYL ACRYLATE) CAS:26124-32-3 | Poly(isopropyl acrylate)is a synthetic polymer that belongs to the class of polyacrylates.It is used in adhesives, coatings,and also as a material for controlled drug delivery systems thanks to its responsiveness to temperature and solvent changes. | price> |
R-M1-8614 | Au/MIL-101(Cr) | The pharmaceutical molecules of 2-mercaptobenzimidazole (MBI) and 2-mercaptobenzothiazole (MBT) with so similar structures can be selectively detected by surface-enhanced Raman spectroscopy (SERS) taking advantage of the fingerprint identification on Au/MIL-101(Cr), with sensitive detection limits of 0.5 ng·mL-1 for MBI and 1 ng·mL-1 for MBT. MBI is selectively enriched by Au/MIL-101(Cr) from the mixture solution and detected by SERS below 30 ng·mL-1. MBI can also be selectively detected in the serum samples with a detection limit of 10 ng·mL-1. The thickness of the MIL-101(Cr) shell was about 120 nm, and the Au NPs (~3 nm) were dispersed on the surface and/or in the pores of MIL-101(Cr). As a kind of MOFs, MIL-101(Cr) has attracted much more attention due to its remarkable zeotype cubic structure including cell volume of ∼702,000 Å3, pore sizes of ∼29 to 34 Å, extra-large Langmuir surface area for N2 of ∼5900 m2 g −1, and its high structural and thermal stability [11,12]. Aut is ideal choices of the basal material to construct metallic nanoparticles due to their unique electronic and catalytic properties, high stability, and convenient electron-transfer ability. | price> |
R-C-6232 | POLY(2-ETHYLHEXYL ACRYLATE) CAS:9003-77-4 | Poly(2-ethylhexyl acrylate) is a synthetic polymer that belongs to the acrylate family. It is a versatile material with diverse applications due to its unique properties.it is in the production of adhesives and sealants. | price> |
R-M1-8615 | TAT-HA2 Fusion Peptide,cas:923954-79-4 | TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety. | price> |
R-C-6233 | POLY(ETHYL ACRYLATE) CAS:9003-32-1 | Poly(ethyl acrylate) is obtained by living anionic polymerization of t-butyl acrylate followed by transesterification with ethanol. | price> |
R-M1-8616 | mPEG-Phosphate, MW 5k | mPEG-Phosphate,MW5k/Diphosphate-mPEG5000/Pyrophosphate-mPEG5000/mPEG-Pyrophosphate, MW 5k/Pyrophosphate-mPEG5K/mPEG-phosphoric acid, MW 5k/Diphosphate-mPEG5000 is useful to PEGylate metal oxide particles and surfaces to form stable monolayer protection. The strong binding properties of organophosphorus to metal oxides result from the creation of a stable M-O-P structure via phosphate metal coordinative interactions. PEG Phosphate-based coupling agents form self-assembled monolayer on the surface of metal oxide nanoparticles such as iron oxide, superparamagnetic particles and upconverting and down-conversion nanoparticles to form thermodynamically stable nanoparticle dispersion. | price> |
R-C-6234 | Poly(cyclohexyl acrylate) CAS:27458-65-7 | Poly(cyclohexyl acrylate) is a type of polymer that is formed through the polymerization of cyclohexyl acrylate monomers. This polymer can be used in various applications such as coatings, adhesives, and as a component in biomedical devices. | price> |