Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-9964	Cholesterol-SS-PEG2000-NHS	Cholesterol-SS-PEG2000-NHS/NHS-PEG2000-SS-Cholesterol is a bifunctional polyethylene glycol derivative Can be used for targeted drug delivery, biomaterial modification, nanoprobes development etc.	price>
R-C-7527	DSPE-PEG-GNYTCEVTELSREGKTVIELK	DSPE-PEG2K-GNYTCEVTELSREGKTVIELK,GNYTCEVTELSREGKTVIELK-PEG-DSPE,DSPE-PEG-CD47,DSPE-PEG-GNYTCEVTESREGKTIELK is a functionalized phospholipid conjugate.DSPE acts as a hydrophobic tail and can be embedded into liposomes, micelles, or cell membranes.PEG (polyethylene glycol)acts as a hydrophilic linking arm,providing steric hindrance,prolonging in vivo circulation time,and reducing immunogenicity.GNYTCEVTELSREGKTIELK is a functional mimic peptide of CD47 protein,which can bind to the SIRP α receptor on the surface of macrophages, transmit the dont eat mesignal,significantly inhibit phagocytosis,and improve the in vivo stability and targeted enrichment efficiency of nanocarriers.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8330	Cy3 Gly-Gly-Gly	Cy3 Gly-Gly-Gly is a Water-soluble, substrate for sortase mediated labeling of proteins. Sortase catalyzes a transpeptidase reaction between a specific internal sequence of a protein and an amine group present on the N-terminus of triglycine recently has become an area of great interest. This method of labeling proteins has been denoted as “Sortagging”.Cy3 is a water-soluble, red fluorescent pH-insensitive from pH 4 to pH 10 probe. Its excitation peak is ideally suited for the 532 nm or 555 nm laser lines and its absorption and emission spectra are almost identical to those of Alexa Fluor® 555, CF® 555 Dye or any other Cyanine3 based fluorescent dyes.	price>
R-C-5948	PEI1.8K-F127-PEI	PEI-F127-PEI,PEI-F127-PEI represents a copolymer between polyethylene imine(PEI)and Pluronic F127. PEI is a multifunctional polymer commonly used in gene delivery and drug delivery systems to assist in carrying nucleic acid molecules such as DNA or RNA.Pluronic F127 is a triblock copolymer commonly used as a surfactant in the field of drug delivery,which can improve drug solubility and reduce drug clearance in the body.Not suitable for human and clinical experiments.	price>
R-M2-9965	Tb-DOTA-tuftsin	Tb-DOTA-tuftsin/Terbium-DOTA-tuftsin conjugates are likely to be a promising optical reagents as probes of the immune response with involvement of macrophage cells in a variety of diseases.Tb-DOTA-tuftsin is internalized by macrophages through a mechanism mediated by pro phagocytin receptors, and its pentapeptide analogue (Tb-DOTA-pentapeptide) has a higher affinity than intact pro phagocytin.It can be applied to targeting, optical imaging, and magnetic resonance imaging (MRI).	price>
R-M1-8331	NHS-TK-PEG-Mal	NHS-TK-PEG-Mal,NHS-thioketal(TK)-PEG-Mal from ruixibio.Thioketal(TK) has the characteristics of active oxygen reaction.In ROS environment, the chemical bond of keto mercaptan breaks, forming ketone and mercaptan, realizing drug release. As the final product, COOH-PEG-thioketal(TK)-Mal has ROS response characteristics, so as to realize the drug delivery system.	price>
R-C-5949	PAMAM G3	PAMAM stands for Polyamide Dendrimers.G3 represents the third generation PAMAM.These dendritic molecules are polymers with highly branched structures that have potential applications in biomedical applications such as drug delivery and imaging.The third-generation PAMAM typically provides a large surface area and biocompatibility through its branched structure, which makes them widely studied and applied in nanomedicine and drug delivery systems.	price>
R-M2-9966	Tb-DOTA-pentapeptide	Tb-DOTA-pentapeptide conjugates/Terbium-DOTA-pentapeptide are likely to be a promising optical reagents as probes of the immune response with involvement of macrophage cells in a variety of diseases.	price>
R-C-7529	DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR	‌DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR‌ is a highly functionalized phospholipid polyethylene glycol peptide conjugate designed for efficient delivery of biomolecules(such as CRISPR RNP complexes,siRNA,or proteins)into specific cells(especially T cells).This molecule combines multiple mechanisms including lipid anchoring,long circulation protection,membrane fusion penetration,and nuclear localization.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8332	R8(RRRRRRRR)	R8 (RRRRRRRR) is a peptide sequence.	price>
R-C-5950	PAMAM G4	PAMAM stands for Polyamide Dendrimers. G4 represents the four generation PAMAM.These dendritic molecules are polymers with highly branched structures that have potential applications in biomedical applications such as drug delivery and imaging.The third-generation PAMAM typically provides a large surface area and biocompatibility through its branched structure,which makes them widely studied and applied in nanomedicine and drug delivery systems.	price>
R-M2-9967	Gd-DOTA-tuftsin	Gd-DOTA-tuftsin/Gd-DOTA-tuftsin(Thr-Lys-Pro-Arg) is a biomarker formed by the binding of gadolinium (Gd) labeled DOTA chelates with tuftsin, mainly used for macrophage specific imaging, especially as a cell specific contrast agent in magnetic resonance imaging (MRI).Gd-DOTA-tuftsin is internalized by macrophages through a mechanism mediated by pro phagocytin receptors, and its pentapeptide analogs (such as Gd DOTA pentapeptide) have higher affinity.	price>
R-C-7530	DSPE-PEG-SFSHHTPILPLCK-RB	DSPE-PEG-SFSHHTPILPLCK-RB is a liver cancer targeted fluorescent labeled liposome construction material suitable for molecular imaging and biological detection of liver cancer cells Constructing targeted nanocarriers to achieve precise delivery of drugs or genes Used for tumor diagnosis, targeted therapy, and efficacy evaluation research.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8333	SH-PEG2K-Transferrin-CY7	SH-PEG2K-Transferrin-CY7 is a peg composite material labeled with cy dye proteins. It can be used for labeling molecules, proteins, drug carriers, cell tracking, fluorescence imaging, and more.	price>
R-C-5951	Oil soluble lnP/znS quantum dot	Oil soluble InP/ZnS quantum dot products are core/shell fluorescent nanomaterials with InP as the core, ZnS as the shell, and hydrophobic ligands wrapped on the surface, with an average quantum yield of 60%. This product has the characteristics of uniform particle size, broad absorption spectrum, narrow and symmetrical emission spectrum, high and stable fluorescence intensity, and is particularly suitable for the green and red components of quantum dot light-emitting diodes (QLEDs).	price>
R-M2-9968	Gd-DOTA-pentapeptide	Gd-DOTA-pentapeptide is a molecular probe formed by the binding of gadolinium (Gd) labeled DOTA chelate with pentapeptide, mainly used for targeted magnetic resonance imaging (MRI). Its core function is to enhance imaging contrast by specifically binding to targets (such as tumor related molecules), achieving high-sensitivity detection of diseases. It can be applied to tumor imaging and vascular diseases. At present, Gd-DOTA derivatives (such as Gd-DOTApentapeptide) exhibit higher relaxation efficiency in liver targeted contrast agents, and the introduction of structures such as pyridine rings can reduce renal accumulation and improve safety.	price>
R-C-7531	DSPE-PEG-IFLLWQRCRR(MAL-SH)	DSPE-PEG2K-IFLLWQRCRR(MAL-SH),IFLLWQRCRR-PEG-DSPE,DSPE-PEG-IFLLWQRCRR is a functionalized phospholipid polyethylene glycol(DSPE-PEG)conjugate that can be used to construct tumor targeted nano drug carriers,achieve precise delivery of chemotherapy drugs or gene drugs, improve drug penetration efficiency in deep tumor tissues,and be used for the development of tumor imaging probes or diagnostic reagents.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8334	BaTiO3@PMMA nanoparticles (100nm)	BaTiO3@PMMA Nanoparticles have a highly thermally conductive organic polymer system with uniform particle dispersion. Their chemical structure and microstructure were characterized by FT-IR, 1H NMR, TGA, and TEM testing techniques, proving that BaTiO3 is coated with a complete PMMA organic molecule on its surface. The prepared composite particles have a clear core-shell structure. Research has shown that when the amount of BaTiO3 nanoparticles added reaches 50% by volume, The thermal conductivity of the polymer system with the addition of unmodified BaTiO3 nanoparticles is 0.894 W.m-1. K 1, while the addition of BaTiO3@PMMA The polymer system of core-shell structure nano hybrid particles reaches 1.137 W-m -1. K-1; Meanwhile, the volume resistivity of both high thermal conductivity polymer systems remains above 1015 Q: cm, still exhibiting good electrical insulation performance.	price>
R-M2-9969	PLGA5K (50/50)-PEG2k-TPP nanoparticles encapsulating resveratrol	PLGA5K (50/50)-PEG2k-TPP nanoparticles encapsulating resveratrol is a functionalized nanocarrier that is expected to improve the delivery efficiency and therapeutic effect of resveratrol through the mitochondrial targeting ability of TPP.This design has significant application value in the fields of drug delivery and biomedical engineering.	price>
R-C-7532	DPG-mPEG	mPEG2K-DPG,DPG-PEG,mPEG-DPG(Methoxy Polyethylene Glycol-1,2-dipalmitoyl-sn-glycerol)is a PEGylated lipid used in research for formulating lipid nanoparticles(LNPs)to enhance drug delivery,stabilize liposomes,and reduce non-specific uptake.This product is only for scientific research and cannot be used on the human body.	price>

111511161117111811191120 11211122112311241125