Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-10089	Ferrocene-DBCO	Ferrocene-DBCO has copper free click chemistry activity, electrochemical and biocompatibility.It is suitable for biomolecule labeling, drug delivery system construction, and biomaterial functionalization.	price>
R-M1-8455	NH2-PEG-TCO	NH2-PEG-TCO,Amine-polyethylene glycol-Transcyclooctene is a versatile compound that can be used in bioconjugation, drug delivery, surface modification, and other chemical and biological applications. Its specific properties and potential applications may depend on the intended purpose and the specific chemical and biological environment in which it is used. Different variations or modifications of the compound may exist to tailor its reactivity, solubility, or targeting capabilities for specific applications.	price>
R-C-6073	N-Linoleoyl-DPPE cas:2148334-94-3	1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-linoleoyl(N-linoleoyl-DPPE)is a specific non-endocannabinoid type of N-acylphosphatidylethanolamine (NAPE).NAPEs are the substrates of a specific phospholiase D(NAPE-PLD)which produces aqueous-soluble bioactive fatty acid amides or N-acylethanolamines.	price>
R-M2-10090	Intermediate FAPI-46	Intermediate FAPI-46 customized product, from ruixibio/kamulinbio.FAPI-46 is a quinoline based fibroblast activation protein (FAP) targeted radiotracer primarily used for tumor imaging of various cancers. Its characteristics include higher tumor uptake rate and prolonged tumor accumulation time.	price>
R-M1-8456	TCO-PEG-MAL	TCO-PEG-MAL,Transcyclooctene-polyethylene glycol-Maleimide from ruixibio.The TCO group in TCO-PEG-MAL is a dienophile that can undergo a rapid and selective reaction with certain diene groups, such as tetrazine or trans-cyclooctene groups. This reaction is commonly used in bioorthogonal chemistry for the specific and efficient conjugation of molecules.By combining the TCO group, PEG linker, and MAL group, TCO-PEG-MAL can be utilized in various chemical and biological applications. It can be used for the conjugation of TCO-PEG-MAL with diene-containing molecules or surfaces using the Diels-Alder or other bioorthogonal click reactions. The presence of the maleimide group also allows for the specific and selective modification of proteins or peptides containing cysteine residues.	price>
R-C-6074	N-Oleoyl-DPPE CAS:113701-57-8	1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-oleoyl(N-oleoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)and an important intermediate in the endocannabinoid biosynthesis pathway.Fatty acid amides are synthesized by a specific phospholiase D(NAPE-PLD)and metabolized by fatty acid amide hydrolases(FAAH)and N-Acylethanolamine acid amidase (NAAA).	price>
R-M2-10091	Ferrocene-Azide	Ferrocene Azide is an organic metal compound that combines ferrocene and azide groups The ferrocene moiety provides stable electron transfer ability, and the azide group can efficiently couple biomolecules or nanomaterials through click chemistry (such as reacting with alkynyl groups). Functional application: Electrochemical labeling: used for labeling antibodies, nucleic acids, etc., achieving high-sensitivity detection through the redox signal of ferrocene. Drug delivery: As a responsive carrier, it triggers drug release in the tumor microenvironment. Biosensors: Modify electrodes to detect small molecules such as H2O2 and lactic acid. Synthesis and stability: Solid phase peptide synthesis or click chemical connection is required, and it should be dried and stored in the dark to maintain activity.	price>
R-MC-001	C18-PEG2k-NOTA	By combining the C18 alkyl group, PEG2k linker, and NOTA chelating agent, C18-PEG2k-NOTA can have potential applications in various fields, such as the development of targeted drug delivery systems, imaging agents, or radiopharmaceuticals. The compounds amphiphilic nature, hydrophobicity, and metal chelation properties make it a versatile candidate for designing functional materials in drug discovery, medical diagnostics, or molecular imaging.	price>
R-C-6075	N-palmitoyl-DPPE (NAPE 16:0) CAS:57984-41-5	1,2-Dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-palmitoyl(N-palmitoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)which as a group includes substrates in the endocannabinoid biosynthesis pathway.	price>
R-M2-10092	CYTIWMPENPRPGTPCDIFTNSRGKRASNG-peg-DMG	The core sequence of CYTIWMPENPRPGTPCDIFTNSRGKRASNG peg DMG is derived from the rabies virus glycoprotein (RVG29) and has the ability to penetrate the blood-brain barrier (BBB). PEGylation can enhance its water solubility and stability, while DMG modification may be used to improve drug delivery properties or bind to specific targets. This peptide is mainly used for targeted therapy of brain diseases, such as drug delivery for neurodegenerative diseases or brain tumors.	price>
R-M1-8458	Bromide-PEG3-biotin	Bromide-Polyethylene glycol--biotin,Bromide-PEG-biotin from ruixi.Biotin can bind to avidin and streptavidin with high specificity and affinity.Bromide-PEG-biotin is a linear heterobifunctional PEG reagent with a Bromide a succinimidyl biotinl ester group. It is a useful crosslinking reagent with a PEG spacer.	price>
R-C-6076	N-Stearoyl Ceramide 1-phosphate CAS：202063-34-1 (free acid), CAS：384835-48-7 (ammonium salt)	Ceramide 1-phosphate(C1P)is biosynthesized from ceramide by the intracellular enzyme Ceramide kinase.C1P inhibits cell apoptosis via inhibition of acid sphingomyelinase activity in contrast to ceramide which promotes apoptosis.	price>
R-M2-10093	Chol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG	Cholesterol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG/Chol-PEG-CYTIWMPENPGTCDIFTNSRGKRASNG is a brain targeted drug delivery system based on RVG29 peptide. This modification scheme is commonly used in delivery systems such as nanoparticles and liposomes, and is suitable for the treatment of gliomas and neurodegenerative diseases.	price>
R-M1-8459	(2E)TCO-PEG4-NHS Ester,cas1613439-69-2	Trans cyclooctene (TCO),as a amphiphilic monomer,has been widely used in biological and material science research due to its advantages of no catalyst and fast reaction rate under physiological conditions.Ruixi can provide products:(2E)TCO-PEG4-NHS Ester.	price>
R-C-6077	N-Stearoyl-DPPE	1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-stearoyl(N-stearoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)and an important intermediate in the endocannabinoid biosynthesis pathway.Fatty acid amides are formed by hydrolysis of NAPEs by a specific phospholiase D (NAPE-PLD),and metabolized by fatty acid amide hydrolases(FAAH).	price>
R-M2-10094	ZIF-8 coated gold nanorods modified with azide	Azide-modified ZIF-8–coated gold nanorods are multifunctional core–shell nanostructures consisting of gold nanorods (AuNRs) encapsulated within a zeolitic imidazolate framework-8 (ZIF-8) shell, with surface azide (–N₃) functional groups introduced for bioorthogonal conjugation. This hybrid nanoplatform integrates the plasmonic photothermal properties of AuNRs with the porous, pH-responsive nature of ZIF-8, while azide groups enable click-chemistry-based surface modification.	price>
R-M1-8460	Sulfo cy3-decadienoic acid	Sulfo-Cy3-decadienoic acid can be utilized in various biological and chemical applications. The sulfo group enhances the water solubility of the compound and can improve the bioavailability and targeting of the molecule.The decadienoic acid moiety has properties similar to a natural membrane component, and can therefore influence the interactions of Sulfo-Cy3-decadienoic acid with membranes and membrane-associated proteins. The presence of the Cy3 moiety allows for visualization and localization of the molecule or associated biomolecules using fluorescence microscopy or other imaging techniques.	price>
R-C-6078	NT1-O14B CAS：2739805-64-0	NT1-O14B is a tryptamine-containing ionizable lipidoid.NT1-O14B has been used in combination with other lipids in the formation of lipid nanoparticles(LNPs).This product is only used for scientific research and is not intended for human or clinical trials.	price>
R-M2-10095	AuNRs@ZIF-8	AuNRs@ZIF-8 are core–shell nanostructures composed of gold nanorods (AuNRs) encapsulated within a zeolitic imidazolate framework-8 (ZIF-8) shell. This hybrid nanoplatform integrates the plasmonic optical properties of gold nanorods with the porous, pH-responsive characteristics of ZIF-8, making it suitable for biomedical and nanotechnology applications.	price>
R-M1-8461	FITC-Recombinant humanized type III collagen	Fibronectin Liposome Encapsulated Resveratrol (FLER)-FITC/Fibronectin Liposome Encapsulated Resveratrol -FITC is a specific chemical compound consisting of a fluorescent dye FITC (fluorescein isothiocyanate) conjugated to a recombinant humanized type III collagen protein. This compound is used in various imaging applications, such as fluorescence microscopy and flow cytometry, to visualize and study the distribution and interaction of collagen in biological systems.	price>

111911201121112211231124 11251126112711281129