Home > Keywords > 
Catalog name Description price
R-C-6099 PI(3)P diC4 CAS:614068-77-6 PI(3)P diC4(Phosphatidylinositol 3-phosphate diC4)is a synthetic,purified dibutanoyl PI(3)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 3-phosphate is enriched in early endosomes having roles in endosome fusion and receptor sorting and internalization in multivesicular bodies. price>
R-M2-10116 CY5-S-sulfo-L-cysteine CY5-S-sulfo-L-cysteine is a compound that combines CY5 fluorescent dye and S-sulfo-L-cysteine, mainly used for biological labeling, immunofluorescence imaging, and flow cytometry. price>
R-M1-8482 FITC-Glucose Oxidase FITC-Glucose Oxidase is a useful tool for studying glucose metabolism and monitoring Glucose Oxidase activity in biological samples through fluorescence detection. price>
R-C-6100 PI(3)P diC8 CAS:214068-76-5 PtdIns(3)P C8,PI(3)P C8,or PI3P C8,PI(3)P diC8(Phosphatidylinositol 3-phosphate diC8)is a synthetic, purified dioctanoyl PI(3)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication. price>
R-M2-10117 FITC-CaCO₃ particles,100-200nm FITC-CaCO₃ particles, 100-200nm(fluorescein labeled calcium carbonate) is a nanoparticle that combines fluorescence tracing and biocompatibility, mainly used for dynamic tracking and functional applications in biomedical and materials science. Main applications: Drug delivery: As a carrier for loading anticancer drugs or gene drugs, drug release and targeting effects are tracked through FITC labeling. Biological imaging: used for in vivo or cellular imaging to study the metabolism and distribution of particles in the body. Organizational engineering: as a scaffold material, combined with fluorescence tracing to observe cell growth and material degradation processes. price>
R-M1-8483 CY5-Gadobutrol CY5-Gadobutrol combines the contrast-enhancing properties of gadobutrol with the fluorescent capabilities of CY5, allowing for the visualization and tracking of the contrast agent in biological samples through fluorescence imaging. price>
R-C-6101 PEG5k-PLA50k-P(HEMA-GMA)15 k Polyethylene glycol (PEG) is a synthetic,hydrophilic polymer that is often used in biomedical and pharmaceutical applications due to its biocompatibility and ability to improve the solubility,stability,and bioavailability of various substances.Poly(2-hydroxyethyl methacrylate)is a hydrophilic polymer often used in the synthesis of hydrogels due to its ability to absorb and retain large amounts of water. Hydrogels are used in various applications including soft contact lenses and as scaffolds in tissue engineering. price>
R-M2-10118 CY3-Clindamycin CY3-Clindamycin is a CY3 fluorescently labeled derivative of Clindamycin, mainly used for fluorescence tracing and biodistribution studies of antibacterial drugs. It combines the antibacterial activity of clindamycin and the fluorescence properties of CY3, making it suitable for in vivo imaging, cell localization, and pharmacokinetic analysis. price>
R-M1-8484 CY2-Cisplatin CY2-Cisplatin represents the fusion of a fluorescent dye (CY2) with the chemotherapeutic agent cisplatin, enabling the visualization and tracking of cisplatin in biological systems using fluorescence-based methods. Cisplatin is a widely used anticancer drug that works by damaging the DNA of cancer cells, leading to their death. It is particularly effective against testicular, ovarian, bladder, and lung cancers. price>
R-C-6102 PI(4,5)P2 diC16 CAS:120595-88-2 Dipalmitoyl Phosphatidylinositol 4,5-bisphosphate,PtdIns(4,5)P2 (16:0/16:0),PI(4,5)P2 C16,or PIP2,Phosphatidylinositol 4,5-bisphosphate diC16 (PI(4,5)P2 diC16)is a synthetic,purified dipalmitoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication. price>
R-M2-10119 DBCO-OVA DBCO-OVA/DBCO-ovalbumin(OVA)/Dibenzocyclooctyne-Ovalbumin is a complex that covalently couples dibenzocyclooctyne (DBCO) with chicken egg albumin (OVA) through bioorthogonal click chemistry (copper free click reaction). It has high reactivity and biocompatibility, and is widely used in fields such as biological labeling, nanomaterial functionalization, biological imaging, and material surface modification. price>
R-M1-8485 FITC- Mucin FITC-Mucin refers to the conjugation of Fluorescein Isothiocyanate (FITC) with Mucin. FITC is a fluorescent dye that is often used to label biomolecules for visualization and detection in biological samples. price>
R-C-6103 PI(4,5)P2 diC4 D-myo-Phosphatidylinositol 4,5-bisphosphate,Dibutanoyl Phosphatidylinositol 4,5-bisphosphate, PtdIns(4,5)P2 C4,PI(4,5)P2 C4,or (4:0/4:0)PIP2,Phosphatidylinositol 4,5-bisphosphate diC4 (PI(4,5)P2 diC4) is a synthetic,purified dibutanoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication. price>
R-M2-10120 DBCO-CpG DBCO-CpG is a complex that combines dibenzocyclooctyne (DBCO) and CpG, mainly used in biological coupling and immunotherapy research.CpG sequence (phosphorothioate backbone):TCGAACGTTCGAACGTTCGAACGTTCGAAT. price>
R-M1-8486 Cy3-dopamine Cy3-Dopamine combines the fluorescent properties of Cy3 with the neurotransmitter dopamine, allowing for the visualization and tracking of dopamine in biological samples using fluorescence-based techniques. price>
R-C-6104 PI(4,5)P2 diC8 CAS:204858-53-7 D-myo-Phosphatidylinositol 4,5-bisphosphate,Dioctanoyl Phosphatidylinositol 4,5-bisphosphate, PtdIns(4,5)P2 C8,PI(4,5)P2 C8,or PIP2,Phosphatidylinositol 4,5-bisphosphate diC8 (PI(4,5)P2 diC8) is a synthetic,purified dioctanoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication. price>
R-M2-10121 Cy5-Thio DNA(CpG1018) Cy5-Thio DNA (CpG1018) is a fluorescently labeled immunostimulant primarily used in vaccine adjuvant research and immune activation experiments. This product is only for scientific research and cannot be used on the human body. price>
R-M1-8487 Fitc-Bovine fibroin FITC-Bovine fibroin combines the fluorescent properties of FITC with the protein bovine fibroin, allowing for the visualization and detection of bovine fibroin in biological samples using fluorescence-based techniques. price>
R-C-6105 PI(4)P diC16 CAS:214332-61-3 D-myo-Phosphatidylinositol 4-phosphate,Dipalmitoyl Phosphatidylinositol 4-phosphate,PtdIns(4)P C16, PI(4)P C16, or PI4P,Phosphatidylinositol 4-phosphate diC16(PI(4)P diC16)is a synthetic,purified dipalmitoyl PI(4)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex. price>
R-M2-10122 DBCO-E7 DBCO-E7 peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) is an E7 derived peptide modified with DBCO (dibenzocyclooctyne), mainly used for biological coupling and targeting research. Application Scenario: Drug delivery: Can be coupled with drugs or nanoparticles for targeted therapy of HPV related tumors. Imaging and Diagnosis: Used to label fluorescent or radioactive probes to assist in disease diagnosis. Mechanism research: Help to elucidate the role of E7 protein in tumorigenesis. price>