Home > Keywords > 
Catalog name Description price
R-C-6075 N-palmitoyl-DPPE (NAPE 16:0) CAS:57984-41-5 1,2-Dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-palmitoyl(N-palmitoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)which as a group includes substrates in the endocannabinoid biosynthesis pathway. price>
R-M2-10092 CYTIWMPENPRPGTPCDIFTNSRGKRASNG-peg-DMG The core sequence of CYTIWMPENPRPGTPCDIFTNSRGKRASNG peg DMG is derived from the rabies virus glycoprotein (RVG29) and has the ability to penetrate the blood-brain barrier (BBB). PEGylation can enhance its water solubility and stability, while DMG modification may be used to improve drug delivery properties or bind to specific targets. This peptide is mainly used for targeted therapy of brain diseases, such as drug delivery for neurodegenerative diseases or brain tumors. price>
R-C-7655 DLPE-PEG-TCO TCO-PEG-DLPE,DLPE as a phospholipid backbone,can effectively embed into the lipid bilayer.PEG provides steric hindrance,extending the circulation time and reducing non-specific adsorption.Meanwhile,TCO serves as a highly reactive tetrazine click reaction partner,enabling rapid and catalyst-free covalent coupling.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8458 Bromide-PEG3-biotin Bromide-Polyethylene glycol--biotin,Bromide-PEG-biotin from ruixi.Biotin can bind to avidin and streptavidin with high specificity and affinity.Bromide-PEG-biotin is a linear heterobifunctional PEG reagent with a Bromide a succinimidyl biotinl ester group. It is a useful crosslinking reagent with a PEG spacer. price>
R-C-6076 N-Stearoyl Ceramide 1-phosphate CAS:202063-34-1 (free acid), CAS:384835-48-7 (ammonium salt) Ceramide 1-phosphate(C1P)is biosynthesized from ceramide by the intracellular enzyme Ceramide kinase.C1P inhibits cell apoptosis via inhibition of acid sphingomyelinase activity in contrast to ceramide which promotes apoptosis. price>
R-M2-10093 Chol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG Cholesterol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG/Chol-PEG-CYTIWMPENPGTCDIFTNSRGKRASNG is a brain targeted drug delivery system based on RVG29 peptide. This modification scheme is commonly used in delivery systems such as nanoparticles and liposomes, and is suitable for the treatment of gliomas and neurodegenerative diseases. price>
R-C-7656 PCL-PEG-NEBP(CGEAIPMSIPPEVK) PCL-PEG-CGEAIPMSIPPEVK,CGEAIPMSIPPEVK-PEG-PCL,NEBP-PEG-PCL,PCL-PEG-NEBP is a multifunctional amphiphilic block copolymer or conjugate used in drug delivery systems, primarily composed of hydrophobic polycaprolactone (PCL),hydrophilic polyethylene glycol(PEG), and the targeting ligand neutrophil elastase-binding peptide(NEBP).It is typically designed for the construction of actively targeted nanoparticles or micelles.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8459 (2E)TCO-PEG4-NHS Ester,cas1613439-69-2 Trans cyclooctene (TCO),as a amphiphilic monomer,has been widely used in biological and material science research due to its advantages of no catalyst and fast reaction rate under physiological conditions.Ruixi can provide products:(2E)TCO-PEG4-NHS Ester. price>
R-C-6077 N-Stearoyl-DPPE 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-stearoyl(N-stearoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)and an important intermediate in the endocannabinoid biosynthesis pathway.Fatty acid amides are formed by hydrolysis of NAPEs by a specific phospholiase D (NAPE-PLD),and metabolized by fatty acid amide hydrolases(FAAH). price>
R-M2-10094 ZIF-8 coated gold nanorods modified with azide Azide-modified ZIF-8–coated gold nanorods are multifunctional core–shell nanostructures consisting of gold nanorods (AuNRs) encapsulated within a zeolitic imidazolate framework-8 (ZIF-8) shell, with surface azide (–N₃) functional groups introduced for bioorthogonal conjugation. This hybrid nanoplatform integrates the plasmonic photothermal properties of AuNRs with the porous, pH-responsive nature of ZIF-8, while azide groups enable click-chemistry-based surface modification. price>
R-C-7657 PLA-PEG-NEBP(CGEAIPMSIPPEVK) PLA-PEG-CGEAIPMSIPPEVK,CGEAIPMSIPPEVK-PEG-PLA,NEBP-PEG-PLA,PLA-PEG-NEBP(CGEAIPMSIPPEVK) is an amphiphilic block copolymer modified material used in drug delivery systems.NEBP (CGEAIPMSIPPEVK)is a short peptide modified at the end that binds specifically to neutrophil elastase,which is highly expressed in the inflammatory/tumor microenvironment.NEBP actively mediates the enrichment of the carrier at the lesion site,enhancing targeting and reducing systemic toxicity and side effects.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8460 Sulfo cy3-decadienoic acid Sulfo-Cy3-decadienoic acid can be utilized in various biological and chemical applications. The sulfo group enhances the water solubility of the compound and can improve the bioavailability and targeting of the molecule.The decadienoic acid moiety has properties similar to a natural membrane component, and can therefore influence the interactions of Sulfo-Cy3-decadienoic acid with membranes and membrane-associated proteins. The presence of the Cy3 moiety allows for visualization and localization of the molecule or associated biomolecules using fluorescence microscopy or other imaging techniques. price>
R-C-6078 NT1-O14B CAS:2739805-64-0 NT1-O14B is a tryptamine-containing ionizable lipidoid.NT1-O14B has been used in combination with other lipids in the formation of lipid nanoparticles(LNPs).This product is only used for scientific research and is not intended for human or clinical trials. price>
R-M2-10095 AuNRs@ZIF-8 AuNRs@ZIF-8 are core–shell nanostructures composed of gold nanorods (AuNRs) encapsulated within a zeolitic imidazolate framework-8 (ZIF-8) shell. This hybrid nanoplatform integrates the plasmonic optical properties of gold nanorods with the porous, pH-responsive characteristics of ZIF-8, making it suitable for biomedical and nanotechnology applications. price>
R-C-7658 DSPE-PEG-Pemafibrate Pemafibrate-PEG-DSPE,The DSPE hydrophobic phospholipid anchoring segment can also be directly embedded into the phospholipid membrane of existing nanocarriers to maintain the stability of the nanostructure.The PEG hydrophilic spacer chain can reduce the phagocytosis of the carrier by the reticuloendothelial system,prolong the blood circulation time,and simultaneously reduce the immunogenicity of the conjugate,enhancing its stability in vivo. Pemafibrate is a conjugated functional drug and a novel selective peroxisome proliferator-activated receptor α(PPARα)modulator.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8461 FITC-Recombinant humanized type III collagen Fibronectin Liposome Encapsulated Resveratrol (FLER)-FITC/Fibronectin Liposome Encapsulated Resveratrol -FITC is a specific chemical compound consisting of a fluorescent dye FITC (fluorescein isothiocyanate) conjugated to a recombinant humanized type III collagen protein. This compound is used in various imaging applications, such as fluorescence microscopy and flow cytometry, to visualize and study the distribution and interaction of collagen in biological systems. price>
R-C-6079 O-LysoPC-d9 (18:1-LPC-d9) 18:1-LPC-d9 refers to a specific form of Lysophosphatidylcholine(LPC)labeled with deuterium(d9)and containing an 18:1 fatty acid chain.Lysophosphatidylcholine is a type of phospholipid that plays essential roles in cell membrane structure,lipid metabolism, and cell signaling.Deuterium labeling is commonly used for research purposes to track the fate and metabolism of lipids within biological systems. price>
R-M2-10096 Chol-PEG2K-RVG29-FAM Chol-PEG2K-RVG29-FAM/Cholesterol-PEG2K-RVG29-FAM/Cholesterol-PEG2000-RVG29-FAM is mainly used for the construction of nanomedicine delivery systems, achieving drug or fluorescent marker enrichment in specific cells or tissues through targeted action of RVG29 peptide. price>
R-C-7659 DSPE-PEG-c(NVVRQC) NVVRQC-PEG-DSPE,The cyclized peptide c(NVVRQC)is the key functional part of DSPE-PEG-c(NVVRQC).The peptide sequence forms a cyclic structure through the cysteine at the end, and this cyclization can significantly enhance the conformational stability and environmental tolerance of the peptide,while maintaining its specific recognition ability.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8462 C14-PEG2K-BIOTIN C14-PEG2K-Biotin is a specific chemical compound that consists of a C14 fatty acid chain, a polyethylene glycol (PEG) linker, and a biotin moiety. By combining the C14 fatty acid chain with the PEG linker and biotin moiety, C14-PEG2K-Biotin can be used as a surfactant, emulsifier, or stabilizer for hydrophobic compounds and nanoparticles. The PEG linker can also prevent non-specific interactions of the compound with biological systems, improving the targeting and specificity of the biotin moiety. The biotin moiety can be used for biotinylating or labeling proteins, antibodies, nucleic acids, or other biomolecules, allowing for their detection, isolation, or purification using streptavidin or avidin-binding assays or columns. price>