Home > Keywords > 
Catalog name Description price
R-C-7653 DSPE-PEG-ASP8-FITC DSPE-PEG-Asp8-FITC is a bone-targeting fluorescent functionalized phospholipid material, which is used for the construction of nanocarrier systems for bone-targeted therapeutic drugs, surface modification of bone repair materials,enhancement of bone integration ability,and fluorescent tracing studies of bone-targeted nanocarriers and bone-related biological processes.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8456 TCO-PEG-MAL TCO-PEG-MAL,Transcyclooctene-polyethylene glycol-Maleimide from ruixibio.The TCO group in TCO-PEG-MAL is a dienophile that can undergo a rapid and selective reaction with certain diene groups, such as tetrazine or trans-cyclooctene groups. This reaction is commonly used in bioorthogonal chemistry for the specific and efficient conjugation of molecules.By combining the TCO group, PEG linker, and MAL group, TCO-PEG-MAL can be utilized in various chemical and biological applications. It can be used for the conjugation of TCO-PEG-MAL with diene-containing molecules or surfaces using the Diels-Alder or other bioorthogonal click reactions. The presence of the maleimide group also allows for the specific and selective modification of proteins or peptides containing cysteine residues. price>
R-C-6074 N-Oleoyl-DPPE CAS:113701-57-8 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-oleoyl(N-oleoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)and an important intermediate in the endocannabinoid biosynthesis pathway.Fatty acid amides are synthesized by a specific phospholiase D(NAPE-PLD)and metabolized by fatty acid amide hydrolases(FAAH)and N-Acylethanolamine acid amidase (NAAA). price>
R-C-7654 DSPE-PEG-NEBP(CGEAIPMSIPPEVK)(SH) DSPE-PEG-CGEAIPMSIPPEVK,CGEAIPMSIPPEVK-PEG-DSPE,NEBP-PEG-DSPE,DSPE-PEG-NEBP is a functionalized phospholipid derivative consisting of hydrophobic phospholipid (DSPE),hydrophilic polyethylene glycol(PEG),and a specific targeting peptide sequence(CGEAIPMSIPPEVK,NEBP).It is primarily used to construct nanomedicine delivery systems with active targeting capabilities.This product is only for scientific research and cannot be used on the human body. price>
R-M2-10091 Ferrocene-Azide Ferrocene Azide is an organic metal compound that combines ferrocene and azide groups The ferrocene moiety provides stable electron transfer ability, and the azide group can efficiently couple biomolecules or nanomaterials through click chemistry (such as reacting with alkynyl groups). Functional application: Electrochemical labeling: used for labeling antibodies, nucleic acids, etc., achieving high-sensitivity detection through the redox signal of ferrocene. Drug delivery: As a responsive carrier, it triggers drug release in the tumor microenvironment. Biosensors: Modify electrodes to detect small molecules such as H2O2 and lactic acid. Synthesis and stability: Solid phase peptide synthesis or click chemical connection is required, and it should be dried and stored in the dark to maintain activity. price>
R-MC-001 C18-PEG2k-NOTA By combining the C18 alkyl group, PEG2k linker, and NOTA chelating agent, C18-PEG2k-NOTA can have potential applications in various fields, such as the development of targeted drug delivery systems, imaging agents, or radiopharmaceuticals. The compounds amphiphilic nature, hydrophobicity, and metal chelation properties make it a versatile candidate for designing functional materials in drug discovery, medical diagnostics, or molecular imaging. price>
R-C-6075 N-palmitoyl-DPPE (NAPE 16:0) CAS:57984-41-5 1,2-Dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-palmitoyl(N-palmitoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)which as a group includes substrates in the endocannabinoid biosynthesis pathway. price>
R-M2-10092 CYTIWMPENPRPGTPCDIFTNSRGKRASNG-peg-DMG The core sequence of CYTIWMPENPRPGTPCDIFTNSRGKRASNG peg DMG is derived from the rabies virus glycoprotein (RVG29) and has the ability to penetrate the blood-brain barrier (BBB). PEGylation can enhance its water solubility and stability, while DMG modification may be used to improve drug delivery properties or bind to specific targets. This peptide is mainly used for targeted therapy of brain diseases, such as drug delivery for neurodegenerative diseases or brain tumors. price>
R-C-7655 DLPE-PEG-TCO TCO-PEG-DLPE,DLPE as a phospholipid backbone,can effectively embed into the lipid bilayer.PEG provides steric hindrance,extending the circulation time and reducing non-specific adsorption.Meanwhile,TCO serves as a highly reactive tetrazine click reaction partner,enabling rapid and catalyst-free covalent coupling.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8458 Bromide-PEG3-biotin Bromide-Polyethylene glycol--biotin,Bromide-PEG-biotin from ruixi.Biotin can bind to avidin and streptavidin with high specificity and affinity.Bromide-PEG-biotin is a linear heterobifunctional PEG reagent with a Bromide a succinimidyl biotinl ester group. It is a useful crosslinking reagent with a PEG spacer. price>
R-C-6076 N-Stearoyl Ceramide 1-phosphate CAS:202063-34-1 (free acid), CAS:384835-48-7 (ammonium salt) Ceramide 1-phosphate(C1P)is biosynthesized from ceramide by the intracellular enzyme Ceramide kinase.C1P inhibits cell apoptosis via inhibition of acid sphingomyelinase activity in contrast to ceramide which promotes apoptosis. price>
R-M2-10093 Chol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG Cholesterol-peg-CYTIWMPENPRPGTPCDIFTNSRGKRASNG/Chol-PEG-CYTIWMPENPGTCDIFTNSRGKRASNG is a brain targeted drug delivery system based on RVG29 peptide. This modification scheme is commonly used in delivery systems such as nanoparticles and liposomes, and is suitable for the treatment of gliomas and neurodegenerative diseases. price>
R-C-7656 PCL-PEG-NEBP(CGEAIPMSIPPEVK) PCL-PEG-CGEAIPMSIPPEVK,CGEAIPMSIPPEVK-PEG-PCL,NEBP-PEG-PCL,PCL-PEG-NEBP is a multifunctional amphiphilic block copolymer or conjugate used in drug delivery systems, primarily composed of hydrophobic polycaprolactone (PCL),hydrophilic polyethylene glycol(PEG), and the targeting ligand neutrophil elastase-binding peptide(NEBP).It is typically designed for the construction of actively targeted nanoparticles or micelles.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8459 (2E)TCO-PEG4-NHS Ester,cas1613439-69-2 Trans cyclooctene (TCO),as a amphiphilic monomer,has been widely used in biological and material science research due to its advantages of no catalyst and fast reaction rate under physiological conditions.Ruixi can provide products:(2E)TCO-PEG4-NHS Ester. price>
R-C-6077 N-Stearoyl-DPPE 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-stearoyl(N-stearoyl-DPPE)is a type of N-acylphosphatidylethanolamine(NAPE)and an important intermediate in the endocannabinoid biosynthesis pathway.Fatty acid amides are formed by hydrolysis of NAPEs by a specific phospholiase D (NAPE-PLD),and metabolized by fatty acid amide hydrolases(FAAH). price>
R-M2-10094 ZIF-8 coated gold nanorods modified with azide Azide-modified ZIF-8–coated gold nanorods are multifunctional core–shell nanostructures consisting of gold nanorods (AuNRs) encapsulated within a zeolitic imidazolate framework-8 (ZIF-8) shell, with surface azide (–N₃) functional groups introduced for bioorthogonal conjugation. This hybrid nanoplatform integrates the plasmonic photothermal properties of AuNRs with the porous, pH-responsive nature of ZIF-8, while azide groups enable click-chemistry-based surface modification. price>
R-C-7657 PLA-PEG-NEBP(CGEAIPMSIPPEVK) PLA-PEG-CGEAIPMSIPPEVK,CGEAIPMSIPPEVK-PEG-PLA,NEBP-PEG-PLA,PLA-PEG-NEBP(CGEAIPMSIPPEVK) is an amphiphilic block copolymer modified material used in drug delivery systems.NEBP (CGEAIPMSIPPEVK)is a short peptide modified at the end that binds specifically to neutrophil elastase,which is highly expressed in the inflammatory/tumor microenvironment.NEBP actively mediates the enrichment of the carrier at the lesion site,enhancing targeting and reducing systemic toxicity and side effects.This product is only for scientific research and cannot be used on the human body. price>
R-M1-8460 Sulfo cy3-decadienoic acid Sulfo-Cy3-decadienoic acid can be utilized in various biological and chemical applications. The sulfo group enhances the water solubility of the compound and can improve the bioavailability and targeting of the molecule.The decadienoic acid moiety has properties similar to a natural membrane component, and can therefore influence the interactions of Sulfo-Cy3-decadienoic acid with membranes and membrane-associated proteins. The presence of the Cy3 moiety allows for visualization and localization of the molecule or associated biomolecules using fluorescence microscopy or other imaging techniques. price>
R-C-6078 NT1-O14B CAS:2739805-64-0 NT1-O14B is a tryptamine-containing ionizable lipidoid.NT1-O14B has been used in combination with other lipids in the formation of lipid nanoparticles(LNPs).This product is only used for scientific research and is not intended for human or clinical trials. price>
R-M2-10095 AuNRs@ZIF-8 AuNRs@ZIF-8 are core–shell nanostructures composed of gold nanorods (AuNRs) encapsulated within a zeolitic imidazolate framework-8 (ZIF-8) shell. This hybrid nanoplatform integrates the plasmonic optical properties of gold nanorods with the porous, pH-responsive characteristics of ZIF-8, making it suitable for biomedical and nanotechnology applications. price>