Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-10118	CY3-Clindamycin	CY3-Clindamycin is a CY3 fluorescently labeled derivative of Clindamycin, mainly used for fluorescence tracing and biodistribution studies of antibacterial drugs. It combines the antibacterial activity of clindamycin and the fluorescence properties of CY3, making it suitable for in vivo imaging, cell localization, and pharmacokinetic analysis.	price>
R-M1-8484	CY2-Cisplatin	CY2-Cisplatin represents the fusion of a fluorescent dye (CY2) with the chemotherapeutic agent cisplatin, enabling the visualization and tracking of cisplatin in biological systems using fluorescence-based methods. Cisplatin is a widely used anticancer drug that works by damaging the DNA of cancer cells, leading to their death. It is particularly effective against testicular, ovarian, bladder, and lung cancers.	price>
R-C-6102	PI(4,5)P2 diC16 CAS:120595-88-2	Dipalmitoyl Phosphatidylinositol 4,5-bisphosphate,PtdIns(4,5)P2 (16:0/16:0),PI(4,5)P2 C16,or PIP2,Phosphatidylinositol 4,5-bisphosphate diC16 (PI(4,5)P2 diC16)is a synthetic,purified dipalmitoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10119	DBCO-OVA	DBCO-OVA/DBCO-ovalbumin(OVA)/Dibenzocyclooctyne-Ovalbumin is a complex that covalently couples dibenzocyclooctyne (DBCO) with chicken egg albumin (OVA) through bioorthogonal click chemistry (copper free click reaction). It has high reactivity and biocompatibility, and is widely used in fields such as biological labeling, nanomaterial functionalization, biological imaging, and material surface modification.	price>
R-M1-8485	FITC- Mucin	FITC-Mucin refers to the conjugation of Fluorescein Isothiocyanate (FITC) with Mucin. FITC is a fluorescent dye that is often used to label biomolecules for visualization and detection in biological samples.	price>
R-C-6103	PI(4,5)P2 diC4	D-myo-Phosphatidylinositol 4,5-bisphosphate,Dibutanoyl Phosphatidylinositol 4,5-bisphosphate, PtdIns(4,5)P2 C4,PI(4,5)P2 C4,or (4:0/4:0)PIP2,Phosphatidylinositol 4,5-bisphosphate diC4 (PI(4,5)P2 diC4) is a synthetic,purified dibutanoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10120	DBCO-CpG	DBCO-CpG is a complex that combines dibenzocyclooctyne (DBCO) and CpG, mainly used in biological coupling and immunotherapy research.CpG sequence (phosphorothioate backbone):TCGAACGTTCGAACGTTCGAACGTTCGAAT.	price>
R-M1-8486	Cy3-dopamine	Cy3-Dopamine combines the fluorescent properties of Cy3 with the neurotransmitter dopamine, allowing for the visualization and tracking of dopamine in biological samples using fluorescence-based techniques.	price>
R-C-6104	PI(4,5)P2 diC8 CAS:204858-53-7	D-myo-Phosphatidylinositol 4,5-bisphosphate,Dioctanoyl Phosphatidylinositol 4,5-bisphosphate, PtdIns(4,5)P2 C8,PI(4,5)P2 C8,or PIP2,Phosphatidylinositol 4,5-bisphosphate diC8 (PI(4,5)P2 diC8) is a synthetic,purified dioctanoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10121	Cy5-Thio DNA(CpG1018)	Cy5-Thio DNA (CpG1018) is a fluorescently labeled immunostimulant primarily used in vaccine adjuvant research and immune activation experiments. This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8487	Fitc-Bovine fibroin	FITC-Bovine fibroin combines the fluorescent properties of FITC with the protein bovine fibroin, allowing for the visualization and detection of bovine fibroin in biological samples using fluorescence-based techniques.	price>
R-C-6105	PI(4)P diC16 CAS:214332-61-3	D-myo-Phosphatidylinositol 4-phosphate,Dipalmitoyl Phosphatidylinositol 4-phosphate,PtdIns(4)P C16, PI(4)P C16, or PI4P,Phosphatidylinositol 4-phosphate diC16(PI(4)P diC16)is a synthetic,purified dipalmitoyl PI(4)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10122	DBCO-E7	DBCO-E7 peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) is an E7 derived peptide modified with DBCO (dibenzocyclooctyne), mainly used for biological coupling and targeting research. Application Scenario: Drug delivery: Can be coupled with drugs or nanoparticles for targeted therapy of HPV related tumors. Imaging and Diagnosis: Used to label fluorescent or radioactive probes to assist in disease diagnosis. Mechanism research: Help to elucidate the role of E7 protein in tumorigenesis.	price>
R-M1-8488	FITC-adipic acid	FITC-Adipic acid can be used in various research areas, such as studying metabolic processes, analyzing metabolic pathways, or investigating the metabolism of adipic acid in organisms or cells.FITC-Adipic acid is a useful tool for visualizing and detecting adipic acid in biological samples using fluorescence-based techniques.	price>
R-C-6106	PI(4)P diC4 CAS:790192-01-7	D-myo-Phosphatidylinositol 4-phosphate,Dibutanoyl Phosphatidylinositol 4-phosphate, PtdIns(4)P C4, PI(4)P C4,or PI4P,Phosphatidylinositol 4-phosphate diC4 (PI(4)P diC4) is a synthetic, purified dibutanoyl PI(4)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10123	C18-CpG-CY5	C18-CpG-CY5/C18-Thio DNA (CpG1018)-CY5 is a fluorescently labeled immunostimulant primarily used in vaccine adjuvant research and immune activation experiments. This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8489	DMG-PEG-R8	DMG-PEG-R8,DMG-PEG-octaarginine for enhanced delivery of a bioactive molecule into cells. The PEG2K component may contribute to improved stability and solubility, while the R8 component may aid in cellular uptake.	price>
R-C-6107	PI(4)P diC8 CAS:214069-07-5	D-myo-Phosphatidylinositol 4-phosphate,Dioctanoyl Phosphatidylinositol 4-phosphate, PtdIns(4)P C8,PI(4)P C8, 8:0/8:0 PI(4)P,Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10124	E7(EPLQLKM)-peg-DMG	E7(EPLQLKM)-peg-DMG/DMG-peg-E7(EPLQLKM)/-peg-DMG is an E7 derived peptide modified with PEG-DMG (di nutmeg glycerol polyethylene glycol), mainly used for targeted drug delivery and biological coupling research. Application: Targeted therapy: can be used in combination with chemotherapy drugs or siRNA for targeted therapy of HPV related tumors. Immune regulation: used in vaccine adjuvants or immunotherapy research, by activating the TLR pathway or regulating immune cell function. Biocoupling: As a connecting arm, it is used to construct peptide drug conjugates (PDCs) or nanocarriers.	price>
R-M1-8490	DMG-PEG-RB	DMG-PEG-RB,1,2-Dimyristoyl-sn-glycerol-methoxypolyethylene glycol-Rhodamine B from ruixibio.The combination of DMG, PEG, and RB in DMG-PEG-RB for specific applications such as enhanced cellular uptake or targeted delivery of a bioactive molecule. The PEG2000 component may contribute to improved solubility, while the RB component can enable fluorescence-based visualization or tracking of the delivered molecule.	price>

114511461147114811491150 11511152115311541155