Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-C-6101	PEG5k-PLA50k-P(HEMA-GMA)15 k	Polyethylene glycol (PEG) is a synthetic,hydrophilic polymer that is often used in biomedical and pharmaceutical applications due to its biocompatibility and ability to improve the solubility,stability,and bioavailability of various substances.Poly(2-hydroxyethyl methacrylate)is a hydrophilic polymer often used in the synthesis of hydrogels due to its ability to absorb and retain large amounts of water. Hydrogels are used in various applications including soft contact lenses and as scaffolds in tissue engineering.	price>
R-M2-10118	CY3-Clindamycin	CY3-Clindamycin is a CY3 fluorescently labeled derivative of Clindamycin, mainly used for fluorescence tracing and biodistribution studies of antibacterial drugs. It combines the antibacterial activity of clindamycin and the fluorescence properties of CY3, making it suitable for in vivo imaging, cell localization, and pharmacokinetic analysis.	price>
R-C-7681	mPEG-pHis	PEG-b-pHis,pHis-MPEG is a polyethylene glycol polyhistidine block copolymer commonly used in biological research,primarily as an intelligent drug carrier or tissue engineering material.This type of material utilizes the pH sensitive property of polyhistidine,which can release drugs in specific environments(such as tumor sites)and has good biocompatibility.	price>
R-M1-8484	CY2-Cisplatin	CY2-Cisplatin represents the fusion of a fluorescent dye (CY2) with the chemotherapeutic agent cisplatin, enabling the visualization and tracking of cisplatin in biological systems using fluorescence-based methods. Cisplatin is a widely used anticancer drug that works by damaging the DNA of cancer cells, leading to their death. It is particularly effective against testicular, ovarian, bladder, and lung cancers.	price>
R-C-6102	PI(4,5)P2 diC16 CAS:120595-88-2	Dipalmitoyl Phosphatidylinositol 4,5-bisphosphate,PtdIns(4,5)P2 (16:0/16:0),PI(4,5)P2 C16,or PIP2,Phosphatidylinositol 4,5-bisphosphate diC16 (PI(4,5)P2 diC16)is a synthetic,purified dipalmitoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10119	DBCO-OVA	DBCO-OVA/DBCO-ovalbumin(OVA)/Dibenzocyclooctyne-Ovalbumin is a complex that covalently couples dibenzocyclooctyne (DBCO) with chicken egg albumin (OVA) through bioorthogonal click chemistry (copper free click reaction). It has high reactivity and biocompatibility, and is widely used in fields such as biological labeling, nanomaterial functionalization, biological imaging, and material surface modification.	price>
R-C-7682	NH2-PEG2k-b-pHis2k	NH2-PEG-b-pHis2k,NH2-PEG-b-pHis,Amine polyethylene glycol-b-poly(L-histidine)(NH2-PEG2k-b-pHis2k)is an amphiphilic block copolymer composed of a polyethylene glycol(PEG)hydrophilic segment with an amino group at the end and a poly-L-htidine(PHis)pH sensitive hydrophobic segment.	price>
R-M1-8485	FITC- Mucin	FITC-Mucin refers to the conjugation of Fluorescein Isothiocyanate (FITC) with Mucin. FITC is a fluorescent dye that is often used to label biomolecules for visualization and detection in biological samples.	price>
R-C-6103	PI(4,5)P2 diC4	D-myo-Phosphatidylinositol 4,5-bisphosphate,Dibutanoyl Phosphatidylinositol 4,5-bisphosphate, PtdIns(4,5)P2 C4,PI(4,5)P2 C4,or (4:0/4:0)PIP2,Phosphatidylinositol 4,5-bisphosphate diC4 (PI(4,5)P2 diC4) is a synthetic,purified dibutanoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10120	DBCO-CpG	DBCO-CpG is a complex that combines dibenzocyclooctyne (DBCO) and CpG, mainly used in biological coupling and immunotherapy research.CpG sequence (phosphorothioate backbone):TCGAACGTTCGAACGTTCGAACGTTCGAAT.	price>
R-C-7683	NH2-PEG550-b-pHis2k	NH2-PEG550-b-pHis2k is a two block copolymer composed of polyethylene glycol (PEG, molecular weight approximately 550 Da) with one end containing an amino group (NH2) and a segment of polyhistidine (pHis, molecular weight approximately 2000 Da) covalently linked together. Belonging to a hybrid bifunctional polymer, it combines the stealth properties of PEG with the proton sponge effect or metal coordination ability of pHis.	price>
R-M1-8486	Cy3-dopamine	Cy3-Dopamine combines the fluorescent properties of Cy3 with the neurotransmitter dopamine, allowing for the visualization and tracking of dopamine in biological samples using fluorescence-based techniques.	price>
R-C-6104	PI(4,5)P2 diC8 CAS:204858-53-7	D-myo-Phosphatidylinositol 4,5-bisphosphate,Dioctanoyl Phosphatidylinositol 4,5-bisphosphate, PtdIns(4,5)P2 C8,PI(4,5)P2 C8,or PIP2,Phosphatidylinositol 4,5-bisphosphate diC8 (PI(4,5)P2 diC8) is a synthetic,purified dioctanoyl PI(4,5)P2.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.	price>
R-M2-10121	Cy5-Thio DNA(CpG1018)	Cy5-Thio DNA (CpG1018) is a fluorescently labeled immunostimulant primarily used in vaccine adjuvant research and immune activation experiments. This product is only for scientific research and cannot be used on the human body.	price>
R-C-7684	SH-PEG2k-b-pHis2k	SH-PEG2k-b-pHis2k (Thiol-polyethylene glycol-b-poly(l-histidine)),molecular weight of 2000Da) is a pH/reduction dual responsive amphiphilic block copolymer with thiol terminated and double block structures of 2000Da molecular weight.It is a commonly used skeleton material for constructing intelligent drug delivery carriers.	price>
R-M1-8487	Fitc-Bovine fibroin	FITC-Bovine fibroin combines the fluorescent properties of FITC with the protein bovine fibroin, allowing for the visualization and detection of bovine fibroin in biological samples using fluorescence-based techniques.	price>
R-C-6105	PI(4)P diC16 CAS:214332-61-3	D-myo-Phosphatidylinositol 4-phosphate,Dipalmitoyl Phosphatidylinositol 4-phosphate,PtdIns(4)P C16, PI(4)P C16, or PI4P,Phosphatidylinositol 4-phosphate diC16(PI(4)P diC16)is a synthetic,purified dipalmitoyl PI(4)P.Phosphoinositides(PIPns)are minor components of cellular membranes but are integral signaling molecules for cellular communication.Phosphatidylinositol 4-phosphate(PI(4)P)is the biosynthetic precursor to PI(4,5)P2 and has an important roles in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex.	price>
R-M2-10122	DBCO-E7	DBCO-E7 peptide (GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) is an E7 derived peptide modified with DBCO (dibenzocyclooctyne), mainly used for biological coupling and targeting research. Application Scenario: Drug delivery: Can be coupled with drugs or nanoparticles for targeted therapy of HPV related tumors. Imaging and Diagnosis: Used to label fluorescent or radioactive probes to assist in disease diagnosis. Mechanism research: Help to elucidate the role of E7 protein in tumorigenesis.	price>
R-C-7685	SH-PEG550-b-pHis2k	SH-PEG550-b-pHis2k is an amphiphilic block copolymer composed of short chain polyethylene glycol(PEG550)with a thiol group(SH)at one end and polyhistidine(pHis2k)blocks. It is mainly used for the construction of nanocarriers and pH responsive delivery systems.	price>
R-M1-8488	FITC-adipic acid	FITC-Adipic acid can be used in various research areas, such as studying metabolic processes, analyzing metabolic pathways, or investigating the metabolism of adipic acid in organisms or cells.FITC-Adipic acid is a useful tool for visualizing and detecting adipic acid in biological samples using fluorescence-based techniques.	price>

114811491150115111521153 11541155115611571158