Home > Keywords > 
Catalog name Description price
R-M2-10247 CCNs-HSA-FITC CaCO3 nanocrystals-HSA-FITC/Calcium carbonate nano-crystals(CCNs)-HSA-FITC/CaCO3 nanocrystals-Human serum albumin-FITC/Calcium carbonate nano-crystals(CCNs)-Human serum albumin-FITC/CCNs-HSA-FITC is a multifunctional composite nanomaterial that uses calcium carbonate (CaCO3) as the inorganic core, covalently couples human serum albumin (HSA) on the surface, and labels fluorescein isothiocyanate (FITC).It combines pH responsiveness, biological targeting, and fluorescence tracing ability, and is widely used in tumor targeted drug delivery and real-time imaging research. price>
R-M1-8613 D-α-tocopheryl polyethylene glycol succinate-NHS D-α-tocopheryl polyethylene glycol succinate-NHS/TPGS-NHS/d-α-tocopheryl polyethylene glycol succinate (TPGS)-NHS/d-α-tocopheryl polyethylene glycol succinate N-hydroxylsuccinimide/TPGS-N-hydroxylsuccinimide can as a potential carrier for controlled delivery of the drug.TPGS can target the mitochondria of cancer cells and leads to their destruction by activating mitochondrial apoptosis mediators This anticancer activity has been shown against cancer cells only and does not affect healthy cells TPGS has been explored in combination therapy with many anticancer drugs, including DOX-loaded nanocarriers. price>
R-C-6231 POLY(ISOPROPYL ACRYLATE) CAS:26124-32-3 Poly(isopropyl acrylate)is a synthetic polymer that belongs to the class of polyacrylates.It is used in adhesives, coatings,and also as a material for controlled drug delivery systems thanks to its responsiveness to temperature and solvent changes. price>
R-M2-10248 CCNs-NH2-FITC-HSA CCNs-NH2-FITC-HSA/CaCO3 Nanocrystals-NH2-FITC-HSA/CCNs(CaCO3 Nanocrystals)-NH2-FITC-HSA/CaCO3 Nanocrystals-NH2-FITC-HSA(Human serum albumin) are a multifunctional composite nanomaterial. This system integrates the pH responsiveness of CaCO3, the chemical activity of -NH2, the fluorescence tracing ability of FITC, and the biological targeting and high compatibility of HSA,making it suitable for tumor targeted drug delivery, real-time imaging, and integrated diagnosis and treatment applications. price>
R-M1-8614 Au/MIL-101(Cr) The pharmaceutical molecules of 2-mercaptobenzimidazole (MBI) and 2-mercaptobenzothiazole (MBT) with so similar structures can be selectively detected by surface-enhanced Raman spectroscopy (SERS) taking advantage of the fingerprint identification on Au/MIL-101(Cr), with sensitive detection limits of 0.5 ng·mL-1 for MBI and 1 ng·mL-1 for MBT. MBI is selectively enriched by Au/MIL-101(Cr) from the mixture solution and detected by SERS below 30 ng·mL-1. MBI can also be selectively detected in the serum samples with a detection limit of 10 ng·mL-1. The thickness of the MIL-101(Cr) shell was about 120 nm, and the Au NPs (~3 nm) were dispersed on the surface and/or in the pores of MIL-101(Cr). As a kind of MOFs, MIL-101(Cr) has attracted much more attention due to its remarkable zeotype cubic structure including cell volume of ∼702,000 Å3, pore sizes of ∼29 to 34 Å, extra-large Langmuir surface area for N2 of ∼5900 m2 g −1, and its high structural and thermal stability [11,12]. Aut is ideal choices of the basal material to construct metallic nanoparticles due to their unique electronic and catalytic properties, high stability, and convenient electron-transfer ability. price>
R-C-6232 POLY(2-ETHYLHEXYL ACRYLATE) CAS:9003-77-4 Poly(2-ethylhexyl acrylate) is a synthetic polymer that belongs to the acrylate family. It is a versatile material with diverse applications due to its unique properties.it is in the production of adhesives and sealants. price>
R-M2-10249 Acrylate-PEG-Thiol Acrylate-PEG-Thiol/Acrylate-PEG-SH is a bifunctional polyethylene glycol derivative. Because of its bifunctional properties, this compound is widely used in the fields of biomaterial modification, drug delivery systems, hydrogel construction and surface functionalization of nanomaterials. price>
R-M1-8615 TAT-HA2 Fusion Peptide,cas:923954-79-4  TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety. price>
R-C-6233 POLY(ETHYL ACRYLATE) CAS:9003-32-1 Poly(ethyl acrylate) is obtained by living anionic polymerization of t-butyl acrylate followed by transesterification with ethanol. price>
R-M2-10250 Acrylate-PEG-Benzaldehyde Acrylate-PEG-Benzaldehyde is a bifunctional polyethylene glycol derivative, which is widely used in the fields of biological coupling, drug delivery systems, hydrogel construction and surface modification of nanomaterials due to its bifunctional properties. price>
R-M1-8616 mPEG-Phosphate, MW 5k mPEG-Phosphate,MW5k/Diphosphate-mPEG5000/Pyrophosphate-mPEG5000/mPEG-Pyrophosphate, MW 5k/Pyrophosphate-mPEG5K/mPEG-phosphoric acid, MW 5k/Diphosphate-mPEG5000 is useful to PEGylate metal oxide particles and surfaces to form stable monolayer protection. The strong binding properties of organophosphorus to metal oxides result from the creation of a stable M-O-P structure via phosphate metal coordinative interactions. PEG Phosphate-based coupling agents form self-assembled monolayer on the surface of metal oxide nanoparticles such as iron oxide, superparamagnetic particles and upconverting and down-conversion nanoparticles to form thermodynamically stable nanoparticle dispersion. price>
R-C-6234 Poly(cyclohexyl acrylate) CAS:27458-65-7 Poly(cyclohexyl acrylate) is a type of polymer that is formed through the polymerization of cyclohexyl acrylate monomers. This polymer can be used in various applications such as coatings, adhesives, and as a component in biomedical devices. price>
R-M2-10251 Artesunate-SS-mPEG2K Artesunate-SS-mPEG2K/mPEG2K-SS-Artesunate/Artesunate-SS-mPEG2000 is a precursor molecule of artemether modified with polyethylene glycol (PEG), which connects the drug and carrier through a reducible disulfide bond (-SS-). It has good biocompatibility and tumor microenvironment responsiveness, and is commonly used to construct redox sensitive drug delivery systems. price>
R-M1-8617 3-Azido-D-alanine HCl,cas1379690-01-3 3-Azido-D-alanine HCl/3-Azido-D-alanine hydrochloride/CAS1379690-01-3 is an aliphatic functionalized amino acid with side chain lengths of up to four carbons.In the area of peptide synthesis as a powerful tool in the development of new therapeutics and biochemistry research. Such modified amino acids can easily undergo click reaction. price>
R-C-6235 POLY(TERT-BUTYL ACRYLATE) CAS:25232-27-3 Poly(tert-butyl acrylate) is a type of polymer that is formed through the polymerization of tert-butyl acrylate monomers.This polymer can be used in various applications such as coatings, adhesives, and elastomers. It has properties such as being flexible,weather-resistant, and having good adhesion to various substrates. price>
R-M2-10252 CY3-Artesunate Cy3-Artesunate/Cyanine3-Artesunate is a fluorescent labeled prodrug that covalently links the red fluorescent dye Cy3 to the molecule of Artesunate. It combines drug activity and optical tracking ability, and is widely used in anti-tumor mechanism research and targeted delivery system development. price>
R-M1-8618 DOTA-PEG4-DBCO DOTA-PEG(4)-DBCO/DOTA-PEG4-dibenzocyclooctyne/DOTA-PEG4-DBCO(dibenzocyclooctyne)/DBCO-PEG4-DOTA is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs. price>
R-C-6236 POLY(N-BUTYL ACRYLATE) CAS:9003-49-0 Poly(n-butyl acrylate) is a polymer that is formed through the polymerization of n-butyl acrylate monomers. It is a versatile polymer commonly used in the production of adhesives, coatings, sealants, and elastomers. Poly(n-butyl acrylate) exhibits properties such as flexibility, good adhesion, and weather resistance, making it suitable for various applications. price>
R-M2-10253 CY5-Artesunate Cy5-Artesunate/Cyanine5-Artesunate is a multifunctional probe molecule formed by covalently coupling Artesunate with near-infrared fluorescent dye Cy5, which combines drug activity and optical visualization ability. It is widely used in anti-tumor, anti malaria mechanism research, and real-time tracking of drug delivery systems. price>
R-M1-8619 Cy3-Dapagliflozin Cyanine3 Dapagliflozin /Dapagliflozin Cyanine3/Cyanine3-Dapagliflozin/Dapagliflozin-Cyanine3/Dapagliflozin-Cy3/Cy3 Dapagliflozin is a fluorescent pathway labeled molecule.It can be used to study the field of type 2 diabetes (T2D). price>