Home > Keywords > 
Catalog name Description price
R-M2-10243 CCNs-NH2,50-70nm Amino functionalization of CaCO3 nanocrystals(CCNs-NH2) is a key strategy for enhancing the biocompatibility and chemical modifiability of calcium carbonate nanocrystals through surface grafting of amino groups (-NH2), widely used in targeted drug delivery and biomedical engineering fields. price>
R-M1-8609 CCK-8 test kit Cell Counting Kit-8/Cell Counting Kit-8 (CCK-8)/CCK8 test kit/Cell Counting Kit-8 (CCK-8)/Cell Counting Kit-8, also known as CCK-8 kit, is a fast and highly sensitive kit based on WST-8 that is widely used for cell activity and cytotoxicity detection. WST-8 is an upgraded product of MTT, and its working principle is that in the presence of electron coupling reagents, it can be reduced by dehydrogenase in mitochondria to produce highly water-soluble orange yellow formazan products. The depth of color is directly proportional to cell proliferation and inversely proportional to cytotoxicity. Using an enzyme-linked immunosorbent assay (ELISA) to measure the OD value at a wavelength of 450nm indirectly reflects the number of living cells. The CCK-8 method is widely used, such as drug screening, cell proliferation assay, cytotoxicity assay, tumor drug sensitivity test, and biological factor activity detection. Stored at 4°C protecting from light, and is stable for up to 12 months. Stored at -20°C protecting from light, and is stable for up to 2 years. price>
R-C-6227 POLY(N,N-DIMETHYLAMINOPROPYL ACRYLAMIDE) Poly(N,N-dimethylaminopropyl acrylamide)(PDMAAm) is a type of synthetic polymer that offers a wide range of applications due to its unique properties.This polymer is known for its thermo-responsive behavior, which means it can undergo reversible solubility transitions in response to changes in temperature,particularly around its lower critical solution temperature (LCST). price>
R-M2-10244 CaCO3 Nanocrystals-NH2-FITC Fluorescein Coupling of Amino-Functionalized CaCO3 Nanocrystals/CaCO3 Nanocrystals-NH2-FITC/CCNs(CaCO3 Nanocrystals)-NH2-FITC are surface functionalized calcium carbonate nanomaterials that combine the drug loading potential of calcium carbonate nanoparticles with the fluorescent labeling ability of FITC. They are commonly used in biological imaging, drug delivery, and cell tracking research. These multifunctional nanocrystals have promising applications in the field of biomedicine, such as serving as targeted drug carriers and real-time monitoring of their distribution in vivo. price>
R-M1-8610 BCN-PEG4-FITC A linker-modified FITC molecule containing a cyclooctyne group (BCN-PEG4-FITC/endo BCN-PEG4-FITC/endo BCN-PEG4-Fluorescein isothiocyanate/Fluorescein isothiocyanate-PEG4-endo BCN) was attached via “Click’’reaction. price>
R-C-6228 POLY(N,N-DIMETHYL ACRYLAMIDE) CAS:26793-34-0 Poly(N,N-dimethyl acrylamide)(PDMA)is a synthetic polymer that belongs to the class of polyacrylamides.PDMA is widely studied for its potential applications in drug delivery systems,tissue engineering, and as a biomaterial due to its biocompatibility and unique thermal responsiveness. price>
R-M2-10245 CCNs-HSA CCNs-HSA/CaCO3 nanocrystals-HSA(Human serum albumin)/HSA on CaCO3 nanocrystals/Human serum albumin on CaCO3 nanocrystals is a composite nanomaterial with calcium carbonate (CaCO3) as the inorganic core and surface modified with human serum albumin (HSA). It is widely used in tumor targeted drug delivery and integrated diagnosis and treatment systems. price>
R-M1-8611 CY5@LNP-RGD(100nm) CY5@Lipid Nanoparticles-RGD(100nm)/CY5@LNP-RGD(100nm)/CY5@RGD-Modified Lipid Nanoparticles(100nm)/Cyanine5@RGD-Modified Lipid Nanoparticles containing a novel pH-sensitive and biodegradable lipid Nanoparticles. It can be used for targeted drug delivery and cancer research. price>
R-C-6229 POLY(2-ACRYLAMIDO-2-METHYLPROPANESULFONIC ACID SODIUM SALT) Synonym: Poly(sodium 2-acrylamido-2-methyl-propanesulfonate).Poly(2-acrylamido-2-methylpropanesulfonic acid sodium salt) or Poly(AMPS)is a synthetic polymer that contains sulfonic acid groups.Due to the presence of sulfonic acid groups,Poly(AMPS)is also utilized as an ion-exchange resin to remove heavy metal ions and other impurities from water.Moreover, its high thermal stability makes it suitable for use in high-temperature applications. price>
R-M2-10246 CCNs-NH2-HSA CCNs-NH2-HSA/CaCO3 nanocrystals-NH2-HSA/Calcium carbonate nano-crystals(CCNs)-NH2-HSA/CaCO3 nanocrystals-NH2-Human serum albumin are a multifunctional composite nanomaterial. This system combines the pH responsiveness of CaCO3, the chemical activity of - NH ₂ groups, and the biocompatibility and targeting ability of HSA, making it suitable for drug delivery, tumor imaging, and integrated diagnosis and treatment applications. price>
R-M1-8612 CY5@LNP(100nm) Cyanine5@LNP(100nm)/CY5@LNP(100nm) /CY5@liposome nanoparticles(100nm) /Cyanine5@liposome nanoparticles(100nm) containing a novel pH-sensitive and biodegradable lipid Nanoparticles. It can be used for targeted drug delivery and cancer research. price>
R-C-6230 POLY(ACRYLAMIDE) CAS:9003-05-8 Poly(acrylamide) is a synthetic polymer that is widely used in various industrial and scientific applications.One of the main applications of poly(acrylamide)is as a flocculant in water treatment processes. It is used to remove solids and impurities from water by causing particles to clump together and settle out, making it easier to separate them from the water. price>
R-M2-10247 CCNs-HSA-FITC CaCO3 nanocrystals-HSA-FITC/Calcium carbonate nano-crystals(CCNs)-HSA-FITC/CaCO3 nanocrystals-Human serum albumin-FITC/Calcium carbonate nano-crystals(CCNs)-Human serum albumin-FITC/CCNs-HSA-FITC is a multifunctional composite nanomaterial that uses calcium carbonate (CaCO3) as the inorganic core, covalently couples human serum albumin (HSA) on the surface, and labels fluorescein isothiocyanate (FITC).It combines pH responsiveness, biological targeting, and fluorescence tracing ability, and is widely used in tumor targeted drug delivery and real-time imaging research. price>
R-M1-8613 D-α-tocopheryl polyethylene glycol succinate-NHS D-α-tocopheryl polyethylene glycol succinate-NHS/TPGS-NHS/d-α-tocopheryl polyethylene glycol succinate (TPGS)-NHS/d-α-tocopheryl polyethylene glycol succinate N-hydroxylsuccinimide/TPGS-N-hydroxylsuccinimide can as a potential carrier for controlled delivery of the drug.TPGS can target the mitochondria of cancer cells and leads to their destruction by activating mitochondrial apoptosis mediators This anticancer activity has been shown against cancer cells only and does not affect healthy cells TPGS has been explored in combination therapy with many anticancer drugs, including DOX-loaded nanocarriers. price>
R-C-6231 POLY(ISOPROPYL ACRYLATE) CAS:26124-32-3 Poly(isopropyl acrylate)is a synthetic polymer that belongs to the class of polyacrylates.It is used in adhesives, coatings,and also as a material for controlled drug delivery systems thanks to its responsiveness to temperature and solvent changes. price>
R-M2-10248 CCNs-NH2-FITC-HSA CCNs-NH2-FITC-HSA/CaCO3 Nanocrystals-NH2-FITC-HSA/CCNs(CaCO3 Nanocrystals)-NH2-FITC-HSA/CaCO3 Nanocrystals-NH2-FITC-HSA(Human serum albumin) are a multifunctional composite nanomaterial. This system integrates the pH responsiveness of CaCO3, the chemical activity of -NH2, the fluorescence tracing ability of FITC, and the biological targeting and high compatibility of HSA,making it suitable for tumor targeted drug delivery, real-time imaging, and integrated diagnosis and treatment applications. price>
R-M1-8614 Au/MIL-101(Cr) The pharmaceutical molecules of 2-mercaptobenzimidazole (MBI) and 2-mercaptobenzothiazole (MBT) with so similar structures can be selectively detected by surface-enhanced Raman spectroscopy (SERS) taking advantage of the fingerprint identification on Au/MIL-101(Cr), with sensitive detection limits of 0.5 ng·mL-1 for MBI and 1 ng·mL-1 for MBT. MBI is selectively enriched by Au/MIL-101(Cr) from the mixture solution and detected by SERS below 30 ng·mL-1. MBI can also be selectively detected in the serum samples with a detection limit of 10 ng·mL-1. The thickness of the MIL-101(Cr) shell was about 120 nm, and the Au NPs (~3 nm) were dispersed on the surface and/or in the pores of MIL-101(Cr). As a kind of MOFs, MIL-101(Cr) has attracted much more attention due to its remarkable zeotype cubic structure including cell volume of ∼702,000 Å3, pore sizes of ∼29 to 34 Å, extra-large Langmuir surface area for N2 of ∼5900 m2 g −1, and its high structural and thermal stability [11,12]. Aut is ideal choices of the basal material to construct metallic nanoparticles due to their unique electronic and catalytic properties, high stability, and convenient electron-transfer ability. price>
R-C-6232 POLY(2-ETHYLHEXYL ACRYLATE) CAS:9003-77-4 Poly(2-ethylhexyl acrylate) is a synthetic polymer that belongs to the acrylate family. It is a versatile material with diverse applications due to its unique properties.it is in the production of adhesives and sealants. price>
R-M2-10249 Acrylate-PEG-Thiol Acrylate-PEG-Thiol/Acrylate-PEG-SH is a bifunctional polyethylene glycol derivative. Because of its bifunctional properties, this compound is widely used in the fields of biomaterial modification, drug delivery systems, hydrogel construction and surface functionalization of nanomaterials. price>
R-M1-8615 TAT-HA2 Fusion Peptide,cas:923954-79-4  TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety. price>