Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-R-5130 | N-(2-aminoethyl)-N-[[4-[[bis(2-aminoethyl)amino]methyl]phenyl]methyl]ethane-1,2-diamine;hydrochlorid | N-(2-aminoethyl)-N-[[4-[[bis(2-aminoethyl)amino]methyl]phenyl]methyl]ethane-1,2-diamine;hydrochloride/CAS No.:71277-17-3 is a versatile material used in scientific research. It exhibits unique properties, making it valuable for various applications including drug delivery systems and catalysis. Its intricate structure enables targeted interactions, leading to promising advancements in the field of chemistry. Please inquire in advance to purchase this product. | price> |
| R-M-987 | Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt,CAS : 147217-25-2 | The myristoylated nonapeptide Myr-FARKGALRQ corresponding to the pseudosubstrate domain of PKC-α and -β subtypes represents a selective and cell-permeable inhibitor of PKC in intact cells. | price> |
| R-C-3461 | MC-PEG750-DSPE | After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively. | price> |
| R-R-5131 | 2,3-Dimethylbenzene-1,4-dicarbonitrile CAS No.:103754-49-0 | 2,3-Dimethylbenzene-1,4-dicarbonitrile/CAS No.:103754-49-0, a chemical compound, possesses diverse applications in scientific research. Its unique properties make it ideal for synthesizing organic compounds, studying molecular interactions, and developing advanced materials. This versatile compound offers immense potential for innovation and breakthroughs in various scientific fields. Please inquire in advance to purchase this product. | price> |
| R-M-988 | 1-Naphthalenylsulfonyl-Ile-Trp-aldehyde | Cell-permeable and reversible inhibitor of cathepsin L, a lysosomal cysteine protease ( IC₅₀ 1.9 nM). 1-Naphthalenylsulfonyl-IW-CHO inhibited the release of Ca²⁺ and hydroxyproline from bone in an in vitro bone culture system. It should be useful for the treatment of osteoporosis. | price> |
| R-C-3462 | MC-DA7R-polyethylene glycol350-DSPE | MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB, target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively. | price> |
| R-R-5132 | 4-Hydroxy-2,5,6-trichloroisophthalonitrile CAS No.:28343-61-5 | 4-Hydroxy-2,5,6-trichloroisophthalonitrile/CAS No.:28343-61-5 is a member of the class of trichlorophenols. It is an isophthalonitrile substituted at positions 2, 4, and 5 by chloro groups and at position 6 by a hydroxy group . It is the major metabolite of chlorothalonil and has a role as a bacterial xenobiotic metabolite . Please inquire in advance to purchase this product. | price> |
| R-M-989 | α-Neoendorphin,CAS : 69671-17-6 | A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. | price> |
| R-C-3463 | DSPE-PEG550-MC-DA7R | MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB, target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively. | price> |
| R-R-5133 | 1,2-Benzenedicarbonitrile, 4,5-dimethyl- CAS No.:36360-43-7 | 1,2-Benzenedicarbonitrile, 4,5-dimethyl- (BDMD)/CAS No.:36360-43-7 is an organic compound with a wide range of applications in scientific research. BDMD is a versatile compound used in the synthesis of organic compounds, and its properties make it an important tool in laboratory experiments. BDMD has been used in a variety of scientific research applications, including drug development and the study of biological systems. Please inquire in advance to purchase this product. | price> |
| R-M-990 | β-Neoendorphin,CAS : 77739-21-0 | A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay. | price> |
| R-C-3464 | MC-DA7R-PEG750-DSPE | MC-DA7R-PEG-DSPE liposome delivery system can transport BBB and BBTB,target glioma cells,stem cells and tumor neovascularization.After doxorubicin was loaded,MC-DA7R-PEG-DSPE liposomes could effectively inhibit tumor angiogenesis and pseudo angiogenesis,promote apoptosis of glioma cells,and reduce the number of glioma stem cells,thus enhancing the anti glioma effect of doxorubicin.The median survival time of the model animals was longer than that of single targeted molecular modified liposomes (MC-PEG-DSPE liposome and DA7R-PEG-DSPE liposome) 63.6% and 38.5% respectively. | price> |
| R-R-5134 | Thieno[3,2-b]thiophene-2,5-dicarbaldehyde CAS No.:37882-75-0 | Thieno[3,2-b]thiophene-2,5-dicarbaldehyde/CAS No.:37882-75-0 is a chemical compound with the empirical formula C8H4O2S2 . It is used as a monomer in the synthesis of Covalent Organic Frameworks (COFs) materials . This molecule has been used in the synthesis of novel metal-free organic dyes for Dye-Sensitized Solar Cells, reaching conversion efficiencies of 6.23% . Please inquire in advance to purchase this product. | price> |
| R-M-991 | Nesfatin-1 (human) trifluoroacetate salt,CAS : 917528-35-9 | Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research. | price> |
| R-C-3465 | GLP-1-polyethylene glycol350-DSPE | Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. | price> |
| R-R-5135 | Naphthalene-1,4-dicarbaldehyde CAS No.:38153-01-4 | Naphthalene-1,4-dicarbaldehyde/CAS No.:38153-01-4, a chemical compound, is widely used in scientific research due to its diverse applications. This versatile material finds use in organic synthesis, fluorescent labeling, and as a building block for various functional molecules. Its unique properties make it a valuable tool in numerous scientific investigations. Please inquire in advance to purchase this product. | price> |
| R-M-992 | Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 | Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research. | price> |
| R-C-3466 | Glucagon like peptide-1-PEG550-DSPE | Glucagon like peptide-1(GLP-1)is a kind of brain gut peptide secreted by ileal endocrine cells.It is mainly used as the target of type 2 diabetes drugs.PEG modification makes the previously insoluble peptides less soluble and highly mobile.PEG modification can reduce the filtration of drugs by kidney,reduce its pyrogen,reduce the digestion of protease, and enhance its transport capacity by protecting the body immune system.GLP-1 has two Lys located in the inactive site,which provides great flexibility for modification. | price> |
| R-R-5136 | 9,10-Anthracenedicarboxaldehyde CAS No.:7044-91-9 | 9,10-Anthracenedicarboxaldehyde/CAS No.:7044-91-9, also known as Anthracene-9,10-dicarbaldehyde, is an acene-9,10-dialdehyde and an anthracenedialdehyde . It is an aggregation-induced emission luminogens (AIEgens) and is used as a reagent in the preparation of porous imine-linked networks (PINs) . Please inquire in advance to purchase this product. | price> |
| R-M-993 | Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8 | Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


