Xi'an ruixi Biological Technology Co

Home > Keywords > DSPE-

Catalog	name	Description	price
R-C-5608	DSPE-PEG2k-MAL	DSPE is a phospholipid derivative and offers lipophilic properties,which facilitate the formation of lipid bilayers and incorporation into liposomes or other lipid-based systems.Polyethylene glycol(PEG)is a hydrophilic polymer that improves the water solubility and stability of drug formulations.It has excellent biocompatibility, lowers immune recognition,and prolongs circulation time.The presence of PEG in DSPE-PEG2k-MAL imparts hydrophilicity to the polymer,which can improve its stability, solubility, and biocompatibility.The maleimide group provides a reactive site for bioconjugation reactions, allowing for the attachment of thiol-containing molecules.	price>
R-C-7188	DSPE-Azobenzene-PEG2k-NHS	DSPE-Azo-PEG-NHS,long chains of DSPE can be embedded into lipid bilayers to form a stable membrane binding interface.Azobenzene groups can undergo cis trans isomerization under light,causing significant changes in molecular conformation.PEG chains prevent non-specific adsorption through steric hindrance effects while maintaining the dispersibility of molecules in the aqueous phase.NHS ester groups can covalently couple with primary amine groups under mild conditions to achieve directed modification of biomolecules.	price>
R-C-7189	DSPE-Azobenzene-PEG2K-NH2	DSPE-Azo-PEG-NH2 is a functionalized amphiphilic phospholipid polymer that provides hydrophobic fatty acid chains,allowing molecules to self assemble into liposomes or micelles in aqueous phase;Azo can undergo cis trans isomerization under UV/visible light irradiation,endowing the system with photoresponsive properties;PEG enhances water solubility and reduces non-specific adsorption.The terminal NH2 is an active contact point that can form amide bonds with carboxyl groups,acyl chlorides,etc.,achieving subsequent chemical coupling.	price>
R-C-5610	DSPE-PEG2K-TPP	DSPE-PEG-TPP,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-(polyethylene glycol) -Triphenyl phosphate (sodium salt) is lipid-PEG drug used for scientific research. Triphenyl phosphate (flame retardant TPP) is a phosphorus-containing compound that can be used as a halogen-free, environmentally friendly flame retardant for dissolution in organic solvents.We can provide peg molecular weights of 1k, 2k, 3.4k, 5k, and 10k for this product.	price>
R-C-7190	DSPE-PEG-CMP(CWLSEAGPVVTVRALRGTGSW)	CMP-PEG-DSPE,DSPE-PEG-CWLSEAGPVVTVRALRGTGSW,DSPE-PEG-CMP is a phospholipid complex composed of three parts.DSPE is a phospholipid that can self assemble into nanoparticles for drug delivery and binding to cell membranes;PEG provides long cycling capability and stability;CMP(CWLSEAGPVVTVRALRGTGSW)is a peptide specifically targeting myocardial cells,allowing the entire complex to precisely act on myocardial tissue.	price>
R-C-7191	DSPE-PEG-NLS(PKKKRKV)	DSPE-PEG-PKKKRKV,NLS-PEG-DSPE,The hydrophobic chains of DSPE can be inserted into liposomes or cell membranes to fix PEG-NLS structures. The hydrophilic layer of PEG reduces plasma protein adsorption and prolongs the carriers retention time in the blood.NLS efficiently guides drugs or plasmids into the nucleus,suitable for gene therapy or nuclear drug delivery.	price>
R-C-5612	DSPE-PEG2K-Rhodamine B(RB)	DSPE-PEG-RB,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-(polyethylene glycol) -Rhodamine B (sodium salt) emitted red fluorescence,Excitation maximum, nm:540,Emission maximum, nm:625,it can be easily detected with fluorescent microscopy,this materials can be used for targeted drug delivery.We can provide peg molecular weights of 1k, 2k, 3.4k, 5k, and 10k for this product.	price>
R-C-5613	DSPE-PEG2K-Carboxylic Acid	The presence of PEG in DSPE-PEG-COOH confers biocompatibility, stealth properties, and improved stability to the resulting lipid-based systems. This makes DSPE-PEG-COOH an attractive candidate for various biomedical applications, such as targeted drug delivery, imaging, or theranostics.	price>
R-C-7193	DSPE-PEG-CGEAIPMSIPPEVK	CGEAIPMSIPPEVK-PEG-DSPE,DSPE-PEG-CGEAIPMSIPPEVK is a phospholipid complex composed of phospholipids(DSPE),polyethylene glycol(PEG),and targeting peptides(CGEAIPMSIPPEVK).DSPE has hydrophobicity and can promote the formation of liposomes or nanoparticles,stabilizing the molecular structure through self-assembly in cell membranes.Polyethylene glycol partially PEG improves the water solubility of the complex, prolongs the blood circulation time of drugs in vivo,CGEAIPMSIPPEVK(Targeted Peptide)is a linear peptide composed of 14 amino acids.	price>
R-C-5616	DSPE-PEG4-Tetrazine	Tetrazine can be used for biorthogonal reactions in many bioimaging and conjugation applications.At present,it is widely used in protein specific site function interpretation,subcellular structure selective labeling,drug targeted delivery,in vivo animal molecular imaging and preparation of biocompatible materials.Polyethylene glycol phospholipid liposomes form high-quality materials, which can be used for drug delivery,gene transfection and vaccine delivery.	price>
R-C-7197	DSPE-TK-PEG-M2pep	DSPE-TK-PEG-M2pep,DSPE provides the basis for liposome membrane structure,with ketothiol bonds that break in a reducing environment(such as high ROS in tumors), releasing PEG chains.PEG(polyethylene glycol) enhances water solubility,cycling stability, and targeting.M2pep(M2 macrophage-targeting peptide)is a linear peptide screened on M2 macrophages using phage display technology,with the sequence YEQDPWGVKWHY.	price>
R-C-7198	DSPE-PEG-CPLGLAGSRDIYSTDYYR(PEG-NH2)	DSPE-PEG-CPLGLAGSRDITDYYR is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CPLGLAGSRDITDYYR.Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,forming a structurally clear and functionally adjustable self-assembly system.	price>
R-C-7199	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH)	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions.	price>
R-C-5620	DSPE-PCB	DSPE-PCB20 had the same ability to enhance the serum stability of lipoplexes. However, quite different from the PEGylation, zwitterionic DSPE-PCB20 could offer stability without interfering with the siRNA encapsulation efficiency and endosomal/lysosomal escape ability of lipoplexes, which was favorable for the systemic delivery of siRNA.	price>
R-C-5621	DSPE-PEG2000-TFFYGGSRGKRNNFKTEEY	The peptide sequence Angiopep-2 (TFFYGGSRGKRNNFKTEEYC) is a specific targeting peptide derived from the protein fibronectin. This peptide is known to have affinity for certain receptors or molecules present on the surface of specific cell types. By conjugating this peptide to DSPE-PEG2000, the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells.	price>
R-C-7201	DSPE-TK-PEG-CSTSMLKAC	DSPE-TK-PEG-CTSSMLKAC is a ROS responsive nanomaterial that combines phospholipids,polyethylene glycol(PEG),and cardiac targeting peptides(CSTSMLKAC).It has targeted delivery and controlled release functions and is mainly used in the treatment of myocardial diseases or drug delivery systems Thioketal is a ROS responsive linker that can be cleaved in high reactive oxygen species(ROS)environments,enabling controlled drug release.	price>
R-C-5622	DSPE-PEG2000-CLSSRLDAC	DSPE(1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a phospholipid that can integrate into the lipid bilayer of liposomes or nanoparticles.PEG2000 refers to the attachment of a polyethylene glycol (PEG) polymer chain of approximately 2000 Daltons in size,providing stealth properties to the formulation and increasing its circulation time in the bloodstream.The peptide sequence CLSSRLDAC is a specific targeting peptide with affinity for certain receptors or molecules present on the surface of specific cells.By conjugating this peptide to DSPE-PEG2000,the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells.	price>
R-C-5623	DSPE-PEG2000-CLPVASC	DSPE-PEG-CLPVASC,The hydrophobic anchoring part is also based on the DSPE skeleton; The intermediate connecting unit is a polyethylene glycol (PEG) segment; Terminal coupled CLPVASC peptide segment, which has specific recognition function; The overall molecular weight varies with PEG length and peptide composition, commonly ranging from 3000-6000 Da; it can self assemble into micelles or embed into lipid bilayer structures in buffered aqueous solutions.	price>
R-C-5624	DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP	DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP,(DSPE) polyethyleneglycol is a combination of phospholipid and polyethylene glycol,which has hydrophilicity and hydrophobicity.Polyethylene glycol liposomes were used to form high-quality materials.It can be used for drug delivery,gene transfection and vaccine delivery.We can also customize various products with different molecular weights.	price>
R-C-5625	DSPE-PEG2K-CPLG	DSPE-PEG-CPLG,DSPE is a phospholipid that can be embedded in the lipid bilayer of liposomes or nanoparticles.Its combination with PEG alters the characteristics of liposomes or nanoparticles,providing stability and enhanced solubility,and prolonging the circulation time of the delivery system in the body. Lecithin (phosphatidylcholine) is a common lipid mainly present in biological cell membranes and plays a crucial role in maintaining cell health and function. In DSPE-PEG lecithin, it may serve as one of the main components, helping to construct a lipid bilayer structure of liposomes or nanoparticles.	price>

78 79 80 81 8283 84 85 86 87 88