Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-M-4012 | Cy2-SE (iodine),cas:186205-33-4 | CY2-SE (Cyanine2 Succinimidyl Ester) is a dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. Excitation (nm):492, Emission (nm): 510. | price> |
| R-M-1741 | c-Myc Peptide Trifluoroacetate | c-Myc Peptide Trifluoroacetate is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription. | price> |
| R-M-4013 | CY7-SE triethylamine | CY7-SE triethylamine is a fluorescence labeling agent (Ex=700-770 nm, Em=790 nm). Cyanine dyes are used to label proteins, antibodies, peptides, and oligonucleotides. | price> |
| R-M-1742 | V5 Epitope Tag Peptide Trifluoroacetate | V5 Epitope Tag Peptide Trifluoroacetate is a Tag Peptide derived from a small Epitope on P and V proteins of monkey-virus paramyxovirus. | price> |
| R-C-4249 | DSPE-PEG350-Glycyrrhetinic acid | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid. | price> |
| R-M-4014 | L-ANAP hydrochloride | L-ANAP hydrochloride is a fluorescent unnatural amino acid used as gene coding and polarity sensitive, which is used in imaging biology research. | price> |
| R-M-1743 | Apelin-13 TFA | Apelin-13 is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. | price> |
| R-C-4250 | DSPE-polyethylene glycol550-Glycyrrhetinic acid | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids. It is a long circulating liposome membrane, formation of micelles in water dispersion, the critical micelle concentration(CMC)ratio of surfactant is 102 times lower, so the drug stability is better, even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting, easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance, which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra. Glycyrrhetinic acid can be regarded as β- A derivative of oleanol, thereby serving as a glycosidic ligand of glycyrrhizic acid. | price> |
| R-M-1744 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia. | price> |
| R-C-4251 | Glycyrrhetinic acid-PEG750-DSPE | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.It is a long circulating liposome membrane,formation of micelles in water dispersion,the critical micelle concentration(CMC)ratio of surfactant is 102 times lower,so the drug stability is better,even by hemodilution, can maintain the integrity of the micelle particle,has certain targeting,easy accumulation in solid tumors. Glycyrrhetinic acid is a pentacyclic triterpenoid substance,which is obtained from glycyrrhizic acid hydrolysis of Glycyrrhiza glabra.Glycyrrhetinic acid can be regarded as β-A derivative of oleanol,thereby serving as a glycosidic ligand of glycyrrhizic acid. | price> |
| R-M-1745 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | price> |
| R-M-4016 | HBC620,cas: 2530162-07-1 | HBC620 is a non fluorescent HBC simulant. HBC is non fluorescent in solution, but it will emit strong fluorescence when forming a close complex with pepper RNA aptamer. HBC pepper complex can be used to observe the dynamic changes of RNA in living cells. | price> |
| R-C-4252 | DSPE-PEG350-CGP | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. | price> |
| R-M-1746 | TFLLR-NH2(TFA),CAS:1313730-19-6 | TFLLR-NH2 (TFA) is a selective PAR1 agonist with an EC50 of 1.9 μM. | price> |
| R-M-4017 | 9-Aminoacridine,cas:90-45-9 | 9-Aminoacridine (Aminacrine) is a highly fluorescent dye used as a topical antiseptic and experimentally as a mutagen, an intracellular pH indicator. 9-Aminoacridine is an effective antibacterial agent with caries-disclosing features. | price> |
| R-C-4253 | DSPE-polyethylene glycol550-CGP | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. | price> |
| R-M-1747 | NLS (PKKKRKV) hydrochloride | NLS (PKKKRKV) hydrochloride is a nuclear localization signal (NLS) derived from the simian virus 40 large tumor antigen (SV40 large T antigen). NLS (PKKKRKV) can function as a method to enhance nuclear entry in the field of gene transfer research. | price> |
| R-M-4018 | 1,3-Diphenylisobenzofuran,cas:5471-63-6 | 1,3-Diphenylisobenzofuran (DPBF) is a fluorescent probe which possesses a highly specific reactivity towards singlet oxygen (1O2) forming an endoperoxide which decomposes to give 1,2-dibenzoylbenzene. 1,3-Diphenylisobenzofuran can detect the generation of reactive oxygen species (ROS). | price> |
| R-C-4254 | choline glycerophosphatide-PEG750-DSPE | DSPE-PEG,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol is a PEG-modified lipids.The most important role of choline glycerophosphatide is that the chemicalbook choline produced by GPC is a water-soluble vitamin B family,which plays an important role in the brain and nervous system.Studies have shown that GPC plays an important role in the production of certain hormones and neurotransmitters such as acetylcholine and human growth hormone,thus supporting the functions of the brain and nervous system. | price> |
| R-M-1749 | Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, CAS:116783-35-8 | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


