Xi'an ruixi Biological Technology Co

Home > Keywords > DSPE-

Catalog	name	Description	price
R-C-7357	DSPE-PEG-D-Ser	D-Ser-PEG-DSPE,DSPE-PEG-D-Ser is a composite molecule composed of phospholipids,polyethylene glycol(PEG),and D-serine,belonging to the functional materials in the field of biochemistry. Its core structure combines the hydrophobicity of phospholipids with the hydrophilicity of PEG through chemical modification,and introduces biologically active D-serine to form a molecular complex that combines stability and functionality.	price>
R-C-5778	DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT	DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.	price>
R-C-5789	DSPE-PEG2000-KKKKKKKKKK	DSPE-PEG-KKKKKKKKKK,DSPE is a phospholipid that can integrate into lipid bilayers due to its hydrophobic and hydrophilic regions.PEG is a polymer that is often attached to lipid molecules to improve their stability,biocompatibility,and circulation time in biological systems.The lysine repeat (KKKKKKKKKK) is a peptide sequence that can interact with negatively charged molecules,such as DNA or RNA,through electrostatic interactions.	price>
R-C-7370	DSPE-galactose	DSPE as a hydrophobic phospholipid scaffold,can be embedded into liposomes or nanoparticles to provide structural stability and efficiently encapsulate lipid soluble or water-soluble drugs.Galactose acts as a targeting ligand,specifically recognizing ASGPR receptors,guiding drugs to actively target liver cells,enhancing therapeutic efficacy,and reducing systemic toxicity.Efficient drug enrichment in the liver is achieved through the specific binding of galactose to ASGPR receptors on the surface of liver cells.	price>
R-C-7373	DSPE-PEG-Brown algae polysaccharide	DSPE-PEG-Brown Algae Polysaccharide is an amphiphilic functionalized conjugate that covalently links natural active polysaccharides with synthetic high molecular weight phospholipids.It combines the self-assembly ability of lipids,the stability of PEG,and the biological activity of brown algae polysaccharides,demonstrating unique potential in the fields of intelligent drug delivery and targeted therapy.This product is only for scientific research and cannot be used on the human body.	price>
R-C-5794	DSPE-P1-PEG2K	DSPE is a surfactant-like lipid that can self-assemble into liposomes or lipid nanoparticles, providing structural stability and drug encapsulation capabilities.The P1 PEGylation pattern refers to the arrangement of PEG molecules along the DSPE backbone.PEGylation can increase circulation time by reducing protein adsorption and recognition by the immune system,leading to improved drug stability and reduced clearance rates.	price>
R-C-7375	DSPE-PEG-CSKSSDYQC	CSKSSDYQC-PEG-DSPE,DSPE-PEG-CSKSSDYQC is a functional molecule that covalently links the goblet cell targeting peptide CSKSSDYQC with phospholipid polyethylene glycol(DSPE-PEG).The molecule is embedded into a liposome or nanoparticle membrane structure through the hydrophobic tail of DSPE,and PEG acts as a hydrophilic spacer arm to enhance colloid stability and prolong circulation time.The exposed CSKSSDYQC peptide segment is responsible for recognizing and binding to M cells or goblet cell surface receptors in Peyers patches of the intestine.This product is only for scientific research and cannot be used on the human body.	price>
R-C-5797	DSPE-PEG2000-OCH3	DSPE-PEG-OCH3,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems such as liposomes and lipid nanoparticles.PEGylation can improve the stability and circulation time of the nanoparticles by reducing interactions with proteins and immune recognition.This can lead to improved drug delivery efficiency and reduced clearance rates.The methoxy group (-OCH3) at the end of the PEG chain in DSPE-PEG-OCH3 is often used as a spacer between the nanoparticle surface and any targeting ligands or functional moieties that may be attached. The methoxy group can provide flexibility and prevent steric hindrance, allowing for effective conjugation of targeting ligands or other molecules.	price>
R-C-7378	DSPE-TK-PEG-CAQK	CAQK-PEG-TK-DSPE,DSPE-TK-PEG-CAQK is a multifunctional intelligent responsive lipid polymer copolymer that has shown great potential in tumor targeted therapy,nerve injury repair,and nucleic acid drug delivery.This material achieves precise and efficient drug delivery through three major mechanisms:ROS responsive release,long cycling characteristics, and tissue-specific targeting.This product is only for scientific research and cannot be used on the human body.	price>
R-C-7379	DSPE-TK-PEG-SFHQFARATLAS	DSPE-TK-PEG-HAP-1,DSPE hydrophobic tail enables self-assembly of liposomes or nanovesicles,PEG2000 chain provides hydration barrier and cycle extension, and the terminal TK bond responds to reactive oxygen species, achieving environment triggered drug release.SFHQFARATLAS(HAP-1 peptide)is a synovial fibroblast(FLS)targeted transduction peptide that can specifically recognize and penetrate FLS that proliferates excessively in RA lesions,with dual functions of targeting and cell penetration.This product is only for scientific research and cannot be used on the human body.	price>
R-C-5800	DSPE-PEG2K-PBP(CDAEWVDVS)	DSPE-PEG-PBP,DSPE is a phospholipid commonly used in the formulation of lipid-based drug delivery systems,providing stability and structure to the nanoparticles.PEGylation involves attaching PEG chains to the molecule,offering improved stability, circulation time, and reduced immunogenicity.The peptide sequence PBP(CDAEWVDVS) is attached to the PEG chain.	price>
R-C-7380	DSPE-PEG-SFHQFARATLAS	SFHQFARATLAS-PEG-DSPE,DSPE-PEG-HAP-1,DSPE-PEG-HAP-1 can be used as a modular tool to further couple mRNA, protein drugs,or immunomodulators,expanding to the development of intelligent treatment systems for autoimmune diseases,osteoarthritis, and other fields.The uniqueness of HAP-1 peptide lies in its combination of targeting and penetration properties,unlike ordinary ligands that can only bind to surface receptors.This product is only for scientific research and cannot be used on the human body.	price>
R-C-5801	DSPE-PEG2K-VHPKQHR	DSPE-PEG-VHPKQHR,By adding a cysteine group to the N-terminus of VHPKQHR peptide, a VCAM-1-binding peptide derived from phage display in vivo85,the linkage of CVHPKQHR to distearoyl phosphoethanolamine-poly(ethylene glycol) 2000-maleimide (DSPE-PEG2000-maleimide) was facilitated through thioether linkage,forming DSPE-PEG2000-VHPKQHR.	price>
R-C-7387	DSPE-PEG-YAGKLLISLSEERISAHHVP-FITC	DSPE-PEG-YAGKLLISLSEERISAHHVP-FITC,it is a multifunctional fluorescent labeled nanocarrier material based on the phospholipid polyethylene glycol(DSPE-PEG)skeleton, constructed by coupling fluorescein labeled peptide YAGKLLISLSERISAHHVP to the end of DSPE-PEG.It is commonly used in targeted imaging and drug delivery system research.This product is only for scientific research and cannot be used on the human body.	price>
R-C-7388	DSPE-PEG-YAGKLLISLSEERISAHHVP	DSPE-PEG2000-YAGKLLISLSEERISAHHVP,DSPE-PEG-YAGKLLISLSERISAHHVP is a functionalized phospholipid polyethylene glycol conjugate primarily used for constructing targeted nanomedicine delivery systems,particularly demonstrating potential in ovarian mitochondrial targeted therapy.YAGKLLISLSERISAHHVP is an ovarian granulosa cell specific targeting peptide that can recognize and bind to cells expressing AMHR Ⅱ,achieving precise drug delivery in ovarian tissue.This product is only for scientific research and cannot be used on the human body.	price>
R-C-7389	DSPE-PEOz-DBCO	DSPE-PEOz2000-DBCO,DBCOPEOz2000-DSPE,DSPE-PEOz-DBCO as an intricately structured amphiphilic block copolymer, exhibits unique physical and chemical behavior. Its molecular skeleton is composed of hydrophobic distearoyl phosphatidylethanolamine (DSPE)and hydrophilic poly(2-ethyl-2-oxazoline)(PEOz)connected by stable covalent bonds,and modified with dibenzocyclooctyne(DBCO)functional groups at the end.This design not only endows the material with good self-assembly ability, but also exhibits excellent micelle formation tendency in aqueous environments.This product is only for scientific research and cannot be used on the human body.	price>
R-C-7393	DSPE-SS-PEG-GalNAC	DSPE-SS-PEG2k-GalNAC,GalNAC-PEG-SS-DSPE,DSPE is the membrane anchoring component that constitutes liposomes or LNPs,providing strong lipophilicity.SS(disulfide bond)is a typical reduction sensitive linking bridge that can be broken in high GSH environments such as tumors,endosomes, and cytoplasm, achieving controlled release. PEG is usually PEG2000 or PEG3400,providing water solubility and stealth function to avoid rapid clearance.(GalNAc)N-acetylgalactosamine is a high affinity ligand for ASGPR, suitable for liver targeted drug delivery systems.	price>
R-C-7394	DSPE-PEG-HYD-cFLFLFK	cFLFLFK-HYD-PEG-DSPE,DSPE provides a lipid structure that facilitates the formation of stable liposomes or micelles,enhances cell membrane affinity,PEG prolongs blood circulation time, reduces immune clearance,and improves biocompatibility.Hyd (hydrazone bond)is hydrolyzed and broken in acidic environments(such as tumor tissue or lysosomes, pH 4.5-6.8),triggering targeted drug release.cFLFK peptide can specifically bind to FPR1 receptors on the surface of immune cells,delivering drugs precisely to the inflammatory or tumor microenvironment,enhancing therapeutic efficacy.This product is only for scientific research and cannot be used on the human body.	price>
R-C-7395	DSPE-PEG-cFLFLFK	DSPE-PEG-cFLFLFK,The lipophilic DSPE phospholipid tail chain can be inserted into the lipid bilayer through hydrophobic interactions;Polyethylene glycol chains provide hydrophilicity and stealth effects,and the cFLFLFK cyclic peptide at the end is a high affinity antagonist of the formyl peptide receptor.It can specifically recognize the overexpressed formyl peptide receptor on the surface of inflammatory cells such as neutrophils and macrophages,achieving active targeted delivery to the site of inflammation.This product is only for scientific research and cannot be used on the human body.	price>
R-C-7396	DSPE-PEG-CNEWQLKSC(NEW)	CNEWQLKSC(NEW)-PEG-DSPE,DSPE-PEG is an amphiphilic block copolymer formed by covalently linking hydrophobic phospholipid fragments(distearoyl phosphatidylethanolamine)with hydrophilic polyethylene glycol segments.This molecular structure simulates the basic characteristics of biofilm phospholipids,while introducing PEG long chains with excellent water solubility and biocompatibility,which exhibit unique self-assembly behavior in aqueous environments.The CNEWQLKSC peptide segment contains cysteine residues(Cys)at both ends,forming an intramolecular disulfide bond or endowing it with specific spatial conformation and targeted recognition functions.This product is only for scientific research and cannot be used on the human body.	price>

85 86 87 88 8990 91 92 93 94 95