Home > Keywords > 
Catalog name Description price
R-M1-8752 TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECATSLNPDYREEDTDVR is a peptide sequence that can be used for drug delivery and targeted research. price>
R-M-5300 BDP-FL-Hydrazide,cas:2183473-45-0 BDP-FL-Hydrazide from ruixi.BDP FL is a bright and photosensitive fluorophore used in fam filter group. This fluorophore is very suitable for microscopy and fluorescence polarization technology. The hydrazide function allows easy binding to carbonyl compounds such as aldehydes and ketones. price>
R-C-4635 DSPE-PEG-Boronate 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-Boronate is a phospholipid PEG polymer which can form lipid bilayer in aqueous solution. Phenyl boronic acid (PBA) moiety has been most widely studied and used in construction of glucose-responsive systems for insulin delivery. Additionally, PBA materials have been used to prepare nanoparticles/micelles for delivering therapeutic agents, such as proteins, SiRNA, anti cancer agent, etc. price>
R-M1-8753 CY7-curcumin Cyanine7-curcumin/Curcumin,Cyanine7 labed/CY7-curcumin is a fluorescent labeled molecular compound that can be used in research fields such as cell tracking and fluorescence imaging. price>
R-M-5301 BDP TMR tetrazine BDP TMR, an orange-fluorescent dye and a full analog of BODIPY™ . Because of its small size and relatively long excitation lifetime, this fluorophore can be used for studying ligand-receptor interactions based on fluorescence polarization.A tetrazine fragment in the molecule can rapidly react with trans-cyclooctene and cyclopropene derivatives in cycloaddition reactions, which result in stable biomolecule-fluorophore conjugates. price>
R-C-4636 DSPE-PEG-Vinylsulfone 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-Vinylsulfone is a self-assembling PEG reagent which forms lipid bilayer. The amphiphilic polymer can be used to prepare liposome for delivering therapeutics, such as nucleic acid (mRNA/DNA) or protein. The vinyl sulfone moiety is reactive with cysteine or other thiol molecule via thiol-ene chemistry. price>
R-M1-8754 Cy5.5-curcumin Cyanine5.5-curcumin/Curcumin,Cyanine5.5 labed/CY5.5-curcumin is a fluorescent labeled molecular compound that can be used in research fields such as cell tracking and fluorescence imaging. price>
R-M-5302 BDP-TMR-Alkyne BDP TMR is a fluorophore for TAMRA filter sets that is significantly brighter than TAMRA due to its high quantum yield. This alkene derivative can be coupled with azides in a copper catalyzed click chemistry reaction. price>
R-C-4637 DSPE-PEG4-acid 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-acid is a PEG linker containing DSPE and carboxylic acid moietiesThe hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. price>
R-M1-8755 COOH-curcumin COOH-curcumin/Carboxylated curcumin/carboxylic-Curcumin from ruixi.The addition of the carboxylic acid group may make COOH-curcumin more amenable to certain chemical reactions or conjugation strategies. It can provide a reactive site for further derivatization or conjugation with other molecules or surfaces. This modification can be useful in applications such as bioconjugation, drug delivery, or targeted therapy. price>
R-M-5303 BDP-TMR-amine BDP-TMR is a fluorophore for TAMRA filter sets. In contrast to TAMRA, however, the dye has a very good quantum yield and thus a high fluorescence intensity.This derivative carries a primary amino group that can be used for conjugation with electrophiles. It is also suitable for enzymatic transamination. price>
R-C-4638 DSPE-PEG5-azide DSPE-PEG5-azide is a heterobifunctional PEG linker.The DSPE-PEGs have been FDA approved for medical applications. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs.The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug.The azide group can undergo copper-catalyzed Click Chemistry reactions with alkynes, DBCO and BCN. price>
R-M1-8756 NapGFFY-TRSAW-COOH NapGFFY-TRSAW-COOH is a peptide sequence that can be used for drug delivery and targeted research. price>
R-M-5304 BDP-TMR-DBCO BDP TMR is one of the dyes BODIPY ™ TMR identical bright fluorophore for TAMRA filter sets with a high quantum yield. Its fluorescence is pH-independent from pH 4 to pH 10 and this dye can be used for dyeing lypophilic compounds due to its hydrophobic properties.BDP-TMR-DBCO initiates bioorthogonal click chemistry reactions with azide-containing molecules. The reaction is driven by ring voltage and also proceeds in the absence of a toxic copper catalyst. price>
R-C-4639 Mannose-Cholesterol-Chito oligosaccharide Mannose is a simple sugar. It is a component of a variety of polysaccharides. It exists in the peel of some plants in a free state. Cholesterol, a derivative of cyclopentane phenanthroline, is a white or light yellow crystal, which is the main steroid compound in mammals. Chitosan oligosaccharide, also known as chitosan oligosaccharide and oligochitosan, is an oligosaccharide product with a polymerization degree between 2 and 20 obtained from the degradation of chitosan by special biological enzyme technology. price>
R-M1-8757 NapGFFY-TRSAWEE-COOH NapGFFY-TRSAWEE-COOH is a peptide sequence that can be used for drug delivery and targeted research. price>
R-M-5305 BDP-TMR-maleimide,cas:2183473-34-7 BDP-TMR-maleimide is a bright bordipyrromethene fluorophore for TAMRA filter sets that reacts with sulfhydryl groups and is therefore suitable for marking protein side chains. price>
R-C-4640 CY7 Labeled PEG Cationic Liposomes Containing Fe3O4&DOX CY7 Labeled PEG Cationic Liposomes Containing Fe3O4&DOX,liposomes are phospholipid vesicles formed by closing one or more concentric lipid bilayer membranes. Inside the vesicles, there are isolated hydrophilic and lipophilic phase spaces. price>
R-M1-8758 NapGFFYEEEEYCWSQYLCY-OH NapGFFYEEEEYCWSQYLCY-OH is a peptide sequence that can be used for drug delivery and targeted research. price>
R-M-5306 BDP 558/568 amine BDP 558/568 amine from ruixi.Primary amine is a versatile functional group for bioconjugation. It is reactive against activated carboxylic acid derivatives like pentafluorophenyl esters and acyl halogenides, other electrophiles like epoxides, Michael acceptors like acrylates. It can aminate carbonyl compounds like aldehydes and ketones in reductive conditions.BDP 558/568 is a universal borondipyrromethene dye with the emission in orange/yellow part of the spectrum. price>