Home > Keywords >
| Catalog | name | Description | price |
|---|---|---|---|
| R-C-4631 | DSPE-PEG4-DBCO | DSPE-PEG4-DBCO is a PEG linker containing DSPE and DBCO moieties. The DSPE-PEGs have been FDA approved for medical applications. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. The DBCO group can be used for copper-free Click Chemistry reactions. Reagent grade, for research use only. | price> |
| R-C-4632 | DSPE-PEG8-Mal | The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. Maleimide groups can react with thiols between pH 6.5 to 7.5. | price> |
| R-M-5298 | BDP R6G hydrazide | BDP R6G is a borondipyrromethene dye whose absorption and emission spectra resemble those of R6G (rhodamine 6G). This hydrazide is a carbonyl-reactive compound that is useful for the labeling of aldehydes, ketones, and most carbohydrates (oxidized with periodate). | price> |
| R-C-4633 | DSPE-PEG12-Mal | DSPE-PEG12-Mal is a PEG linker containing DSPE and maleimide moieties. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The maleimide group will react with a thiol group to form a covalent bond, enabling the connection of biomolecule with a thiol. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. | price> |
| R-M1-8751 | NH2-PEG3-Biotin | Amine-peg3-Biotin/Biotin-peg3-Amine/Biotin-peg3-NH2/NH2-PEG3-Biotin provides a versatile tool for biotin-mediated binding and immobilization in various biological or analytical applications. | price> |
| R-M-5299 | BDP R6G tetrazine | BDP R6G is a borondipyrromethene dye that has absorption and emission wavelengths close to rhodamine 6G (R6G). BDP R6G is a very bright and photostable dye.Tetrazine fragment is used in inverse electron demand Diels Alder reaction with trans-cyclooctenes, acylazetines, and other strained olefins. | price> |
| R-C-4634 | DSPE-PEG-Iodoacetyl | DSPE-PEG-Iodoacetyl , MW 2,000 is a thiol reactive phospholipid polyPEG. The iodoacetyll group is reactive with thiol to produce a thioether linkage. The polymer can self-assemble in water to form lipid bilayer and can be used to encapsulate drugs in targeted delivery application, such as liposomal doxorubicin as an anti cancer drug or mRNA vaccine. | price> |
| R-M1-8752 | TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR | TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECATSLNPDYREEDTDVR is a peptide sequence that can be used for drug delivery and targeted research. | price> |
| R-M-5300 | BDP-FL-Hydrazide,cas:2183473-45-0 | BDP-FL-Hydrazide from ruixi.BDP FL is a bright and photosensitive fluorophore used in fam filter group. This fluorophore is very suitable for microscopy and fluorescence polarization technology. The hydrazide function allows easy binding to carbonyl compounds such as aldehydes and ketones. | price> |
| R-C-4635 | DSPE-PEG-Boronate | 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-Boronate is a phospholipid PEG polymer which can form lipid bilayer in aqueous solution. Phenyl boronic acid (PBA) moiety has been most widely studied and used in construction of glucose-responsive systems for insulin delivery. Additionally, PBA materials have been used to prepare nanoparticles/micelles for delivering therapeutic agents, such as proteins, SiRNA, anti cancer agent, etc. | price> |
| R-M1-8753 | CY7-curcumin | Cyanine7-curcumin/Curcumin,Cyanine7 labed/CY7-curcumin is a fluorescent labeled molecular compound that can be used in research fields such as cell tracking and fluorescence imaging. | price> |
| R-M-5301 | BDP TMR tetrazine | BDP TMR, an orange-fluorescent dye and a full analog of BODIPY™ . Because of its small size and relatively long excitation lifetime, this fluorophore can be used for studying ligand-receptor interactions based on fluorescence polarization.A tetrazine fragment in the molecule can rapidly react with trans-cyclooctene and cyclopropene derivatives in cycloaddition reactions, which result in stable biomolecule-fluorophore conjugates. | price> |
| R-C-4636 | DSPE-PEG-Vinylsulfone | 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-Vinylsulfone is a self-assembling PEG reagent which forms lipid bilayer. The amphiphilic polymer can be used to prepare liposome for delivering therapeutics, such as nucleic acid (mRNA/DNA) or protein. The vinyl sulfone moiety is reactive with cysteine or other thiol molecule via thiol-ene chemistry. | price> |
| R-M1-8754 | Cy5.5-curcumin | Cyanine5.5-curcumin/Curcumin,Cyanine5.5 labed/CY5.5-curcumin is a fluorescent labeled molecular compound that can be used in research fields such as cell tracking and fluorescence imaging. | price> |
| R-M-5302 | BDP-TMR-Alkyne | BDP TMR is a fluorophore for TAMRA filter sets that is significantly brighter than TAMRA due to its high quantum yield. This alkene derivative can be coupled with azides in a copper catalyzed click chemistry reaction. | price> |
| R-C-4637 | DSPE-PEG4-acid | 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-acid is a PEG linker containing DSPE and carboxylic acid moietiesThe hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs. The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug. | price> |
| R-M1-8755 | COOH-curcumin | COOH-curcumin/Carboxylated curcumin/carboxylic-Curcumin from ruixi.The addition of the carboxylic acid group may make COOH-curcumin more amenable to certain chemical reactions or conjugation strategies. It can provide a reactive site for further derivatization or conjugation with other molecules or surfaces. This modification can be useful in applications such as bioconjugation, drug delivery, or targeted therapy. | price> |
| R-M-5303 | BDP-TMR-amine | BDP-TMR is a fluorophore for TAMRA filter sets. In contrast to TAMRA, however, the dye has a very good quantum yield and thus a high fluorescence intensity.This derivative carries a primary amino group that can be used for conjugation with electrophiles. It is also suitable for enzymatic transamination. | price> |
| R-C-4638 | DSPE-PEG5-azide | DSPE-PEG5-azide is a heterobifunctional PEG linker.The DSPE-PEGs have been FDA approved for medical applications. The hydrophobic properties of the DSPE allow for the encapsulation and congregation of other hydrophobic drugs.The hydrophilic PEG linker increases the water solubility of the overall compound allowing for the delivery of the drug.The azide group can undergo copper-catalyzed Click Chemistry reactions with alkynes, DBCO and BCN. | price> |
| R-M1-8756 | NapGFFY-TRSAW-COOH | NapGFFY-TRSAW-COOH is a peptide sequence that can be used for drug delivery and targeted research. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


