Product peptide-synthetic-peptide

Home > products > peptide> synthetic-peptide

Catalog	name	Description	price
R-M-990	β-Neoendorphin,CAS : 77739-21-0	A hypothalamic opioid peptide related to Leu-enkephalin and dynorphin A with potent activity in the guinea-pig ileum assay.	price>
R-M-991	Nesfatin-1 (human) trifluoroacetate salt，CAS : 917528-35-9	Nesfatin-1 (human) trifluoroacetate salt,CAS:917528-35-9 from ruixi.It is a synthetic peptide.It can be applied to obesitity research.	price>
R-M-992	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0	Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0 is a synthetic peptide.It can be used for Obesity Research.	price>
R-M-993	Nesfatin-1 (30-59) (human) trifluoroacetate salt,CAS:1872441-21-8	Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.	price>
R-M-994	nesfatin-1-30-59-mouse-rat-trifluoroacetate-salt,CAS :1872441-22-9	Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake. The mouse sequence differs in two positions from the human fragment.	price>
R-M-995	Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1	Nesfatin-1 (rat) trifluoroacetate salt,CAS: 917528-37-1 from ruixi. It is a synthetic peptide.It can be used for Obesity Research.	price>
R-M-996	Nesfatin-1-Like Peptide (mouse) trifluoroacetate salt	The insulinotropic peptide encoded by nucleobindin 1 upregulated preproinsulin mRNA expression and insulin secretion.	price>
R-M-998	Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt,CAS : 954420-51-0	Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt ,CAS:954420-51-0 from ruixi.It can be used in the study of Parkinson disease.	price>
R-M-999	Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt,CAS:1872441-24-1	Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt,CAS:1872441-24-1 from ruixi.It is a synthetic peptide.	price>
R-M-1000	Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt	For chemical reasons the sequence of NERP-3 has been elongated N-terminally by a Gly-residue.	price>

...