Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-C-5778	DSPE-PEG2K-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT	DSPE-PEG-CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT,DSPE is a phospholipid commonly used in the formulation of liposomes and lipid-based nanoparticles. It has a hydrophobic tail that can anchor into a lipid bilayer, while the hydrophilic headgroup enhances biocompatibility.PEGylation can prolong circulation time, reduce immunogenicity, and minimize protein adsorption.The PEG end can be coupled with various peptides, such as CACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.	price>
R-M2-9796	Biotin-PEG3-Artesunate	Biotin-PEG3-Artesunate is a targeted drug conjugate designed to enhance the delivery, solubility, and selectivity of artesunate-a potent antimalarial and anticancer agent.	price>
R-M1-8162	Octadecyl-peg2k-sulphate	Octadecyl-peg2k-sulphate,Octadecyl polyethylene glycol sulphate/sulfate(ion) It is a bifunctional peg reagent.	price>
R-C-5779	Mesoporous silica encapsulated drug (Requinmod) 50NM	Mesoporous silica is a highly structured and ordered nanomaterial with a large number of pores and a high specific surface area. The encapsulation of Risedronate into 50 nanometer sized mesoporous silica can achieve efficient drug transport and controlled release. Mesoporous silica can also provide a certain protective effect to prevent the decomposition and deactivation of drugs.	price>
R-M2-9797	DMG-PEG3.4K-HHLGGAKQAGDV	DMG-PEG3.4K-HHLGGAKQAGDV is a stealthy, lipid-anchored, integrin-targeting peptide conjugate, well-suited for applications in Cardiovascular drug delivery,Inflammation-targeted nanocarriers,Liposome surface functionalization,Thrombus imaging or therapy.	price>
R-M1-8163	3,3-Dioctyl-2,25,2-terthiophene,CAS:155166-89-5	3,3-Dioctyl-2,2 5,2-terthiophene (DOT) is a novel organic compound with potential applications in a variety of fields. It is a polycyclic aromatic hydrocarbon (PAH) that has a planar, aromatic structure and a wide range of physical and chemical properties. DOT is a highly versatile compound, and its unique properties make it an attractive candidate for a variety of applications in materials science, pharmaceuticals, and biochemistry.	price>
R-C-5780	Ag2Te QDs (Oil phase) transmit:1500	Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution.transmit:1500	price>
R-M2-9798	Chol-PEG3.4K-HHLGGAKQAGDV	Cholesterol-PEG3.4K-HHLGGAKQAGDV is a rationally engineered molecule designed to: Embed into lipid-based nanoparticles; Present an integrin-targeting peptide (especially for platelet or vascular targeting); Enable fluorescence imaging, drug delivery, or antithrombotic treatment.	price>
R-M1-8164	Ni-NTA-Nano gold,10 nm	Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting.	price>
R-C-5781	Ag2Te QDs (aqueous phase) transmit:1500	Ag2Te QDs (Ag2Te) is an effective biological probe in the second near-infrared window (NIR-II) that can be used in bioimaging with high tissue penetration depth and high spatiotemporal resolution.	price>
R-M2-9799	GGG-PEG3-N3	GGG-PEG3-N3/Gly-Gly-Gly-PEG3-Azide is a modular linker used in click chemistry, bioconjugation, and site-selective surface modifications and peptide-based materials, surface tagging, or nanoconjugate development.	price>
R-C-5782	TCPP-Cu(2+) CAS:41699-93-8	Cu(II) meso-Tetra(4-carboxyphenyl)porphine is a synthetic porphyrin.CU(II) Meso-tetra(4-carboxyphenyl)porphine has has been studied for its versatile applications across various fields,including catalysis,electrochemistry, photochemistry, and biochemistry.In catalysis,this compound has exhibited exceptional efficacy as a catalyst,facilitating diverse organic reactions like alcohol oxidation and nitro compound reduction.	price>
R-M1-8165	Ni-NTA-Nanogold,5 nm	5 nm Ni-NTA-Nanogold® provides new features, improved performance, and extends NTA-Ni(II) targeting technology to larger gold size.Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting.	price>
R-M2-9800	Hemin-PEG2K	Hemin-PEG2K/Hemin-PEG2000 is a likely synthetic conjugate designed to combine:the redox bioactivity of hemin and the pharmacokinetic advantages of PEG2K.It would be suitable for chemodynamic therapy, catalytic nanomedicine, or biomaterial functionalization.	price>
R-M1-8166	1.8nm Ni-NTA-Nanogold	Ni-NTA-Nanogold is designed for detection or localization of polyhistidine (his) -tagged fusion proteins using electron microscopy, light microscopy or blotting.	price>
R-C-5783	PEI1.8K-Nonadecafluorodecanoic Acid	PEI-Nonadecafluorodecanoic Acid,Polyethyleneimine (PEI) is a cationic polymer with repeating ethyleneimine units.Nonadecafluorodecanoic acid (NFDA) is a perfluorinated carboxylic acid with nineteen fluorine atoms. It is a hydrophobic compound that can interact with hydrophobic surfaces or molecules.When PEI and NFDA are combined, they can form a complex through electrostatic interactions and hydrophobic interactions. The positive charges of PEI can interact with the carboxylate groups of NFDA, while the hydrophobic fluorocarbon chain of NFDA can interact with hydrophobic entities.	price>
R-M2-9801	Hemin-N3	Hemin-N3 referring to azide-modified hemin, is a bioactive complex widely studied for both coordination chemistry and nanomedicine.It typically involves hemin (ferric protoporphyrin IX) forming complexes with azide (N3-) ligands either for catalytic activity, spin-state studies, or as precursors in click chemistry functionalization. Hemin-N3 is a redox-active azide complex of hemin.Useful for modeling enzymatic active sites and catalytic behavior.Frequently integrated into nanoparticle surfaces or used for click chemistry.	price>
R-M1-8167	mPEG5K-FHKHKSPALSPV	mPEG5K-FHKHKSPALSPV is a synthetic peptide compound.	price>
R-C-5784	PLGA5000-b-PEOz2000-NHS	PLGA-b-PEOz-NHS,PLGA-PEOz-NHS,PLGA-PEOz-NHS is an amphiphilic AB diblock copolymer composed of hydrophilic PEOz and hydrophobic poly(D,L-lactide co glycolide).PEOz polymers are capped by active esters and can react with other reactive chemical groups such as amino modified proteins,peptides,and other materials.PEOz can completely replace PEG polyethylene glycol as a drug carrier material and can be used to prepare pH responsive nanoparticles for drug delivery.	price>
R-M2-9802	Biotin-Loureirin A	Biotin-Loureirin A refers to a synthetic bioconjugate. Such a conjugate would be designed for molecular targeting, bioassays or surface immobilization.	price>

106010611062106310641065 10661067106810691070