Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M1-8331	NHS-TK-PEG-Mal	NHS-TK-PEG-Mal,NHS-thioketal(TK)-PEG-Mal from ruixibio.Thioketal(TK) has the characteristics of active oxygen reaction.In ROS environment, the chemical bond of keto mercaptan breaks, forming ketone and mercaptan, realizing drug release. As the final product, COOH-PEG-thioketal(TK)-Mal has ROS response characteristics, so as to realize the drug delivery system.	price>
R-C-5949	PAMAM G3	PAMAM stands for Polyamide Dendrimers.G3 represents the third generation PAMAM.These dendritic molecules are polymers with highly branched structures that have potential applications in biomedical applications such as drug delivery and imaging.The third-generation PAMAM typically provides a large surface area and biocompatibility through its branched structure, which makes them widely studied and applied in nanomedicine and drug delivery systems.	price>
R-M2-9966	Tb-DOTA-pentapeptide	Tb-DOTA-pentapeptide conjugates/Terbium-DOTA-pentapeptide are likely to be a promising optical reagents as probes of the immune response with involvement of macrophage cells in a variety of diseases.	price>
R-C-7529	DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR	‌DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR‌ is a highly functionalized phospholipid polyethylene glycol peptide conjugate designed for efficient delivery of biomolecules(such as CRISPR RNP complexes,siRNA,or proteins)into specific cells(especially T cells).This molecule combines multiple mechanisms including lipid anchoring,long circulation protection,membrane fusion penetration,and nuclear localization.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8332	R8(RRRRRRRR)	R8 (RRRRRRRR) is a peptide sequence.	price>
R-C-5950	PAMAM G4	PAMAM stands for Polyamide Dendrimers. G4 represents the four generation PAMAM.These dendritic molecules are polymers with highly branched structures that have potential applications in biomedical applications such as drug delivery and imaging.The third-generation PAMAM typically provides a large surface area and biocompatibility through its branched structure,which makes them widely studied and applied in nanomedicine and drug delivery systems.	price>
R-M2-9967	Gd-DOTA-tuftsin	Gd-DOTA-tuftsin/Gd-DOTA-tuftsin(Thr-Lys-Pro-Arg) is a biomarker formed by the binding of gadolinium (Gd) labeled DOTA chelates with tuftsin, mainly used for macrophage specific imaging, especially as a cell specific contrast agent in magnetic resonance imaging (MRI).Gd-DOTA-tuftsin is internalized by macrophages through a mechanism mediated by pro phagocytin receptors, and its pentapeptide analogs (such as Gd DOTA pentapeptide) have higher affinity.	price>
R-C-7530	DSPE-PEG-SFSHHTPILPLCK-RB	DSPE-PEG-SFSHHTPILPLCK-RB is a liver cancer targeted fluorescent labeled liposome construction material suitable for molecular imaging and biological detection of liver cancer cells Constructing targeted nanocarriers to achieve precise delivery of drugs or genes Used for tumor diagnosis, targeted therapy, and efficacy evaluation research.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8333	SH-PEG2K-Transferrin-CY7	SH-PEG2K-Transferrin-CY7 is a peg composite material labeled with cy dye proteins. It can be used for labeling molecules, proteins, drug carriers, cell tracking, fluorescence imaging, and more.	price>
R-C-5951	Oil soluble lnP/znS quantum dot	Oil soluble InP/ZnS quantum dot products are core/shell fluorescent nanomaterials with InP as the core, ZnS as the shell, and hydrophobic ligands wrapped on the surface, with an average quantum yield of 60%. This product has the characteristics of uniform particle size, broad absorption spectrum, narrow and symmetrical emission spectrum, high and stable fluorescence intensity, and is particularly suitable for the green and red components of quantum dot light-emitting diodes (QLEDs).	price>
R-M2-9968	Gd-DOTA-pentapeptide	Gd-DOTA-pentapeptide is a molecular probe formed by the binding of gadolinium (Gd) labeled DOTA chelate with pentapeptide, mainly used for targeted magnetic resonance imaging (MRI). Its core function is to enhance imaging contrast by specifically binding to targets (such as tumor related molecules), achieving high-sensitivity detection of diseases. It can be applied to tumor imaging and vascular diseases. At present, Gd-DOTA derivatives (such as Gd-DOTApentapeptide) exhibit higher relaxation efficiency in liver targeted contrast agents, and the introduction of structures such as pyridine rings can reduce renal accumulation and improve safety.	price>
R-C-7531	DSPE-PEG-IFLLWQRCRR(MAL-SH)	DSPE-PEG2K-IFLLWQRCRR(MAL-SH),IFLLWQRCRR-PEG-DSPE,DSPE-PEG-IFLLWQRCRR is a functionalized phospholipid polyethylene glycol(DSPE-PEG)conjugate that can be used to construct tumor targeted nano drug carriers,achieve precise delivery of chemotherapy drugs or gene drugs, improve drug penetration efficiency in deep tumor tissues,and be used for the development of tumor imaging probes or diagnostic reagents.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8334	BaTiO3@PMMA nanoparticles (100nm)	BaTiO3@PMMA Nanoparticles have a highly thermally conductive organic polymer system with uniform particle dispersion. Their chemical structure and microstructure were characterized by FT-IR, 1H NMR, TGA, and TEM testing techniques, proving that BaTiO3 is coated with a complete PMMA organic molecule on its surface. The prepared composite particles have a clear core-shell structure. Research has shown that when the amount of BaTiO3 nanoparticles added reaches 50% by volume, The thermal conductivity of the polymer system with the addition of unmodified BaTiO3 nanoparticles is 0.894 W.m-1. K 1, while the addition of BaTiO3@PMMA The polymer system of core-shell structure nano hybrid particles reaches 1.137 W-m -1. K-1; Meanwhile, the volume resistivity of both high thermal conductivity polymer systems remains above 1015 Q: cm, still exhibiting good electrical insulation performance.	price>
R-M2-9969	PLGA5K (50/50)-PEG2k-TPP nanoparticles encapsulating resveratrol	PLGA5K (50/50)-PEG2k-TPP nanoparticles encapsulating resveratrol is a functionalized nanocarrier that is expected to improve the delivery efficiency and therapeutic effect of resveratrol through the mitochondrial targeting ability of TPP.This design has significant application value in the fields of drug delivery and biomedical engineering.	price>
R-C-7532	DPG-mPEG	mPEG2K-DPG,DPG-PEG,mPEG-DPG(Methoxy Polyethylene Glycol-1,2-dipalmitoyl-sn-glycerol)is a PEGylated lipid used in research for formulating lipid nanoparticles(LNPs)to enhance drug delivery,stabilize liposomes,and reduce non-specific uptake.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8335	Biotin-EIAALEKEIAALEKEIAALEK-NH2	Biotin-EIAALEKEIAALEKEIAALEK-NH2 is a sequence peptide compound.	price>
R-M2-9970	DOTA-PA1	DOTA-PA1(Pan-SSTRs Targeted Precursor PA Derivative) is a chelator-peptide conjugate derived from a pan-somatostatin analogue (referred to as “PA1”), designed to target multiple somatostatin receptor subtypes (SSTR₁, SSTR₂, SSTR₃, SSTR₅). It incorporates the macrocyclic chelator DOTA to enable radiometal complexation (e.g., ^64Cu, ^68Ga) for PET/SPECT imaging or radionuclide therapy.	price>
R-C-7533	DPG-PEG-DBCO	DBCO-PEG-DPG,DPG-PEG2k-DBCO,DBCO-PEG-DPG is an innovative amphiphilic molecule that combines long-chain hydrophilic spacer arms with biofilm compatible lipid anchoring groups. Dipalmitoyl glycerol ester(DPG)is a structurally simple synthetic lipid with a double long-chain saturated hydrocarbon tail that exhibits strong hydrophobicity and can stably anchor in lipid bilayer membranes or hydrophobic interfaces.This product is only for scientific research and cannot be used on the human body.	price>
R-M1-8336	Biotin-EIAALEKEIAALEKEIAALEKEIAALEK-NH2	Biotin-EIAALEKEIAALEKEIAALEKEIAALEK-NH2 is a sequence peptide compound.	price>
R-M2-9971	68Ga-DOTA-PA1	68Ga-DOTA-PA1 is a novel PET radiotracer, targeting multi-subtypes of SSTRs, and was confirmed to be useful for PET imaging. It may have potential as a noninvasive PET radiotracer for imaging SSTR-positive tumors.68Ga-DOTA-PA1 had high radiochemical yield and radiochemical purity of over 95% and 99%, respectively. PA1:new pan-somatostatin receptors (pan-SSTRs) probe PA1/new pan-SSTRs targeted precursor PA derivative (PA1)	price>

111811191120112111221123 11241125112611271128