Xi'an ruixi Biological Technology Co

Home > Keywords >

Catalog	name	Description	price
R-M2-10249	Acrylate-PEG-Thiol	Acrylate-PEG-Thiol/Acrylate-PEG-SH is a bifunctional polyethylene glycol derivative. Because of its bifunctional properties, this compound is widely used in the fields of biomaterial modification, drug delivery systems, hydrogel construction and surface functionalization of nanomaterials.	price>
R-M1-8615	TAT-HA2 Fusion Peptide,cas:923954-79-4	TAT-HA2 Fusion Peptide/Trans-Activator of Transcription (TAT)-HA2 Fusion Peptide/RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG/H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety.	price>
R-C-6233	POLY(ETHYL ACRYLATE) CAS:9003-32-1	Poly(ethyl acrylate) is obtained by living anionic polymerization of t-butyl acrylate followed by transesterification with ethanol.	price>
R-M2-10250	Acrylate-PEG-Benzaldehyde	Acrylate-PEG-Benzaldehyde is a bifunctional polyethylene glycol derivative, which is widely used in the fields of biological coupling, drug delivery systems, hydrogel construction and surface modification of nanomaterials due to its bifunctional properties.	price>
R-M1-8616	mPEG-Phosphate, MW 5k	mPEG-Phosphate,MW5k/Diphosphate-mPEG5000/Pyrophosphate-mPEG5000/mPEG-Pyrophosphate, MW 5k/Pyrophosphate-mPEG5K/mPEG-phosphoric acid, MW 5k/Diphosphate-mPEG5000 is useful to PEGylate metal oxide particles and surfaces to form stable monolayer protection. The strong binding properties of organophosphorus to metal oxides result from the creation of a stable M-O-P structure via phosphate metal coordinative interactions. PEG Phosphate-based coupling agents form self-assembled monolayer on the surface of metal oxide nanoparticles such as iron oxide, superparamagnetic particles and upconverting and down-conversion nanoparticles to form thermodynamically stable nanoparticle dispersion.	price>
R-C-6234	Poly(cyclohexyl acrylate) CAS:27458-65-7	Poly(cyclohexyl acrylate) is a type of polymer that is formed through the polymerization of cyclohexyl acrylate monomers. This polymer can be used in various applications such as coatings, adhesives, and as a component in biomedical devices.	price>
R-M2-10251	Artesunate-SS-mPEG2K	Artesunate-SS-mPEG2K/mPEG2K-SS-Artesunate/Artesunate-SS-mPEG2000 is a precursor molecule of artemether modified with polyethylene glycol (PEG), which connects the drug and carrier through a reducible disulfide bond (-SS-). It has good biocompatibility and tumor microenvironment responsiveness, and is commonly used to construct redox sensitive drug delivery systems.	price>
R-M1-8617	3-Azido-D-alanine HCl,cas1379690-01-3	3-Azido-D-alanine HCl/3-Azido-D-alanine hydrochloride/CAS1379690-01-3 is an aliphatic functionalized amino acid with side chain lengths of up to four carbons.In the area of peptide synthesis as a powerful tool in the development of new therapeutics and biochemistry research. Such modified amino acids can easily undergo click reaction.	price>
R-C-6235	POLY(TERT-BUTYL ACRYLATE) CAS:25232-27-3	Poly(tert-butyl acrylate) is a type of polymer that is formed through the polymerization of tert-butyl acrylate monomers.This polymer can be used in various applications such as coatings, adhesives, and elastomers. It has properties such as being flexible,weather-resistant, and having good adhesion to various substrates.	price>
R-M2-10252	CY3-Artesunate	Cy3-Artesunate/Cyanine3-Artesunate is a fluorescent labeled prodrug that covalently links the red fluorescent dye Cy3 to the molecule of Artesunate. It combines drug activity and optical tracking ability, and is widely used in anti-tumor mechanism research and targeted delivery system development.	price>
R-M1-8618	DOTA-PEG4-DBCO	DOTA-PEG(4)-DBCO/DOTA-PEG4-dibenzocyclooctyne/DOTA-PEG4-DBCO(dibenzocyclooctyne)/DBCO-PEG4-DOTA is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.	price>
R-C-6236	POLY(N-BUTYL ACRYLATE) CAS:9003-49-0	Poly(n-butyl acrylate) is a polymer that is formed through the polymerization of n-butyl acrylate monomers. It is a versatile polymer commonly used in the production of adhesives, coatings, sealants, and elastomers. Poly(n-butyl acrylate) exhibits properties such as flexibility, good adhesion, and weather resistance, making it suitable for various applications.	price>
R-M2-10253	CY5-Artesunate	Cy5-Artesunate/Cyanine5-Artesunate is a multifunctional probe molecule formed by covalently coupling Artesunate with near-infrared fluorescent dye Cy5, which combines drug activity and optical visualization ability. It is widely used in anti-tumor, anti malaria mechanism research, and real-time tracking of drug delivery systems.	price>
R-M1-8619	Cy3-Dapagliflozin	Cyanine3 Dapagliflozin /Dapagliflozin Cyanine3/Cyanine3-Dapagliflozin/Dapagliflozin-Cyanine3/Dapagliflozin-Cy3/Cy3 Dapagliflozin is a fluorescent pathway labeled molecule.It can be used to study the field of type 2 diabetes (T2D).	price>
R-C-6237	POLY(N-OCTYL ACRYLATE) cas:25266-13-1	PnOctA,Poly(n-octyl acrylate) is a polymer that is formed through the polymerization of n-octyl acrylate monomers.poly(n-octyl acrylate) possesses good weather resistance, which makes it suitable for outdoor applications.	price>
R-M2-10254	CY7-Artesunate	Cy7-Artesunate/Cyanine7-Artesunate is a multifunctional probe molecule formed by covalent coupling of near-infrared fluorescent dye Cy7 with artemether, which combines drug activity and optical tracking ability. It is widely used in anti malaria, anti-tumor research, and visual tracking of drug delivery systems.	price>
R-M1-8620	UiO-66(Ce)-CH3	A series of functionalized metal–organic frameworks (MOFs):UiO-66(Ce)-CH3/Universitetet i Oslo-66(cerium)-CH3 for the photocatalytic oxidation of benzylamine under visible light. And it has a high conversion rate. The quantity and the acid strength of coordinatively unsaturated Ce sites as Lewis acid sites are modulated by ligand functionalization, both following the order of UiO-66(Ce)-CH3 > UiO-66(Ce)-H > UiO-66(Ce)-Br > UiO-66(Ce)-NO2, which is closely related to photocatalytic performance.	price>
R-C-6238	POLY(N-NONYL ACRYLATE)	Poly(n-nonyl acrylate)is a polymer that is formed through the polymerization of n-nonyl acrylate monomers.It is utilized in a range of applications,including coatings,adhesives,and sealants.The polymer possesses properties such as flexibility and adhesion,making it suitable for various industrial uses.Poly(n-nonyl acrylate)is also employed in the production of paints,inks,and pressure-sensitive adhesives due to its capacity to adhere to a variety of surfaces.For further information on its characteristics,potential uses,or safety considerations,consulting specific chemical databases or regulatory sources may be beneficial.	price>
R-M2-10255	FITC-Cellulose	Fluorescein labeled cellulose (FITC cellulose) is a fluorescent labeled polysaccharide material that covalently binds fluorescein isothiocyanate (FITC) to natural cellulose. It is widely used in fields such as biological imaging, cell adhesion research, microenvironment tracking, and material visualization tracking. This material combines the excellent biocompatibility and stability of cellulose with the green fluorescence properties of FITC, and has important application value in scientific research.	price>
R-M1-8621	Ce-UiO-66-NH2	UiO-66(Ce)-NH2/UiO-66-NH2 (Ce) has a catalytic effect on the reaction of CO2 with epoxy propane. It was found that the addition of Ce ions can effectively reduce the number of UiO-66-NH2 connections The BET results show that the specific surface area first increases and then decreases with the increase of Ce content When the Ce/Zr molar ratio is 5%, UiO-66-NH2 (Zr/Ce) has the highest catalytic activity, because its larger specific surface area and pore volume are more conductive to catalytic reactions.Depositing Ce-UiO-66-NH2/UiO-66-NH2 (Ce) on diatomaceous earth composite materials and then forming a self-assembled membrane as a functional layer can improve the performance of the membrane.	price>

115511561157115811591160 11611162116311641165