Home > Keywords > 
Catalog name Description price
R-Mcs-449 L-a-PC:Chol:DPPE-N-dbco:Fluorescent Lipid Dansyl lipid (headgroup)(68.5:30:1:0.5molar ratio) L-a-PC:Chol:DPPE-N-dbco:Fluorescent Lipid Dansyl lipid (headgroup)(68.5:30:1:0.5molar ratio) is a type of lipid nanocomposite material. Applications: Targeted liposome design via azide–DBCO click chemistry. Fluorescently trackable drug delivery systems. In vitro and in vivo imaging of liposomal behavior. price>
R-M2-9903 DMG-PEG-CREKA DMG-PEG-CREKA is a peptide conjugate.Applications:Widely used for constructing tumor-targeted liposomes, micelles, and nanoparticles for drug delivery, imaging, and theranostic purposes, combining stealth properties with vascular targeting capability. price>
R-M2-9921 DMG-PEG2K-CSKRSELDKKISIAAK DMG-PEG2000-CSKRSELDKKISIAAK/CSKRSELDKKISIAAK-PEG2000-DMG is a peptide conjugate.This multifunctional structure enables surface functionalization of liposomes or lipid nanoparticles with targeting or cell-interacting capabilities. Applications: Targeted liposomal or lipid nanoparticle formulation for drug or nucleic acid delivery. Surface modification of lipid-based carriers to improve cellular uptake or tissue targeting. Biointerface engineering for biosensing or peptide–membrane interaction studies. Gene therapy and nanomedicine research, particularly where membrane anchoring and biorecognition are required. Applications: Targeted liposomal or lipid nanoparticle formulation for drug or nucleic acid delivery. Surface modification of lipid-based carriers to improve cellular uptake or tissue targeting. Biointerface engineering for biosensing or peptide–membrane interaction studies. Gene therapy and nanomedicine research, particularly where membrane anchoring and biorecognition are required. price>
R-C-7183 Chitosan,degree of deacetylation≥85%, MW~30k Chitosan is a naturally derived polysaccharide that is widely present in the shells of crustaceans such as shrimp and crabs,as well as in the cell walls of fungi. price>
R-C-013 PDLLA8k-azobenzene-PEG2k PLA-AZO-MPEG,PDLLA8k-azobenzene-PEG2k is a block copolymer composed of Poly(D,L-lactide)(PDLLA),azobenzene,and polyethylene glycol(PEG).The PDLLA segment provides hydrophobicity and biodegradability,and is commonly used to form the hydrophobic core of nanoparticles.Azobenzene,as a photoresponsive switch,changes from trans to cis under ultraviolet light,causing molecular chain contraction;Restore the original state under visible light and achieve reversible deformation PEG endows materials with hydrophilicity,reduces immune system recognition, and prolongs blood circulation time. price>
R-C-6660 Mannose-cholesterol Mannose cholesterol is a compound formed by the chemical bond between mannose and cholesterol,belonging to the class of glycolipids.The mannose group enables it to specifically recognize and bind to cells expressing mannose receptors,such as macrophages and dendritic cells,while the cholesterol group helps it fuse with the cell membrane,promoting intracellular delivery of drugs or genes. price>
R-Mcs-500 AKG/CY5@ROS Responsive carrier PLGA-RVG29(100nm) AKG/CY5@ROS Responsive carrier PLGA-RVG29 (100nm)/AKG/CY5@PLGA-RVG29 (100nm) is a multifunctional brain targeted nanoparticle with a particle size of approximately 100 nm. Using PLGA-RVG29 as the carrier skeleton, it has the ability to release reactive oxygen species (ROS) responsive drugs and can synergistically deliver alpha ketoglutarate (AKG) and near-infrared fluorescent dye CY5. It is designed for targeted therapy and real-time imaging of neurodegenerative diseases such as disease of Parkinson. price>
R-C-7528 DSPE-PEG-PLGLAGAAQYQDRYYDEFTWKEKDMDYW DSPE-PEG2K-PLGLAGAAQYQDRYYDEFTWKEKDMDYW,DSPE acts as a hydrophobic tail and can be embedded into liposomes,micelles,or cell membranes.PEG(polyethylene glycol)acts as a hydrophilic linking arm,providing steric hindrance,prolonging in vivo circulation time,and reducing immunogenicity.DSPE-PEG can couple various peptides(PLGLAGAAQYQDRYYDEFTWKEKDMDYW) and other functional groups.This product is only for scientific research and cannot be used on the human body. price>
R-R-5751 DOPE-PEG-CTFVKALTMDGKQAAWR CTFVKALTMDGKQAAWR-PEG-DOPE,DOPE-PEG-CTFVKALTMDGKQAAWR is a customized functionalized lipid conjugate primarily used for constructing lipid nanocarriers with specific targeting or functional recognition capabilities.This product is only for scientific research and cannot be used on the human body. price>
R-66665 NH2-PEG-Mannose Amine-polyethylene glycol-Mannose, NH2-PEG-Mannose from RuixiBio is a linear heterobifunctional PEG reagent with a Amine and a Mannose group. price>
R-S0001 mPEG-SS-DSPE mPEG-SS-DSPE,1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-SS-[(polyethylene glycol)-methoxy] (sodium salt) price>
RZ-140 Tocopherol-PEG-COOH Tocopherol-polyethylene glycol-carboxyl,Tocopherol-PEG-COOH from ruixi.Tocopherol is the hydrolysate of vitamin E (VE). All natural tocopherols are d-tocopherol (dextral type). It has eight isomers, such as α, β, ϒ and δ. Among them, α - tocopherol has the strongest activity. The d-mixed-tocopherol concentrate, used as antioxidant, is a mixture of various isomers of natural tocopherol. price>
R-Ir-3515 fac-Ir[d-F(p-t-Bu)ppy]3 The products of Ruixi Biotechnology Co.,Ltd. include: synthetic phospholipids, polymer polyethylene glycol derivatives,block copolymers,magnetic nanoparticles,gold nanoparticles and gold nanorods,near-infrared fluorescent dyes,reactive fluorescent dyes,dendrimers,cyclodextrin derivatives,popular cancer raw materials,fluorescent quantum dots,hyaluronic acid derivatives,graphene or gold nanorods Graphene oxide, carbon nanotubes,fullerenes,silica and mesoporous silica,near infrared fluorescent dyes,polystyrene microspheres,upconversion nanoparticles,MRI products,fluorescent proteins and fluorescent probes.The company can also make synthetic customized products,such as fac-Ir[d-F(p-t-Bu)ppy]3. price>
R-XASYS-00501 3-Deazaneplanocin A,cas:102052-95-9 3-Deazaneplanocin A(C12H14N4O3,262.3) is a cyclopentenyl analog of 3-deazaadenosine, originally synthesized as an inhibitor of S-adenosyl-L-homocysteine hydrolase.It has been shown to deplete EZH2 levels and to inhibit trimethylation of lysine 27 on histone H3 in cultured human acute myeloid leukemia (AML) HL-60 and OCI-AML3 cells and in primary AML cells in a dose-dependent manner (0.2-1μM). price>
R-R-0501 Laminin Nonapeptide amide Laminin Nonapeptide, Amide/CAS:110590-61-9, refers to a specific sequence of nine amino acids derived from the larger protein called laminin. Laminin is a major component of the extracellular matrix, a structural and functional support network in tissues. price>
R-Mcs-501 LipoCP loaded curcumin and PDA,100nm-200nm LipoCP loaded curcumin and PDA(Curcumin content 21mg, PDA content 21mg),100nm-200nm is a multifunctional liposome nanocarrier with a particle size controlled within the range of 100-200 nm. It can co load curcumin and polydopamine (PDA), and has the potential for antioxidant, anti-inflammatory, photothermal conversion, and tumor targeting. It is suitable for synergistic therapy and integrated diagnosis and treatment research of cancer. price>
R-S0002 DSPE-SS-PEG-COOH DSPE-SS-PEG-COOH,1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-SS-(polyethylene glycol)-carboxylic acid price>
R-66666 MAL-PEG-Mannose MAL-poly(ethylene glycol)-Mannose,MAL-PEG-Mannosefrom RuixiBio is a linear heterobifunctional PEG reagent with a MAL and a Mannose group. price>
RZ-141 DSPE-PEG-KRWWKWWRR,MW:2K DSPE-PEG-KRWWKWWRR is a multifunctional conjugate composed of phospholipids(DSPE),polyethylene glycol(PEG),and antimicrobial peptides(KRWWKWWRR),mainly used for the construction of drug delivery systems.The KRWWKWWRR peptide can specifically bind to targets, enhancing the carriers targeting of bacteria or diseased tissues. price>
R-Ir-3516 fac-Ir(p-CF3ppy)3 Ruixi Biotechnology Co.,Ltd.is a well-known biological company in China.It has synthesized the planar Tri(2-(4-trifluoromethylphenyl)pyridine)iridium complex(FAC IR(tfmppy)31 and obtained its crystal structure.Ruixi can also provide customized products,such as fac-Ir(p-CF3ppy)3. price>