| Catalog | name | Description | price |
|---|---|---|---|
| R-0060 | DSPE-PEG-6-FAM | FAM-PEG-DSPE,DSPE-PEG-5(6)-FAM,1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-PEG-Carboxyfluorescein,DSPE-PEG-FAM is a type of functionalized phospholipid polyethylene glycol conjugate that combines lipid anchoring,hydrophilic stability,and fluorescence tracing.It is composed of hydrophobic distearoyl phosphatidylethanolamine (DSPE),hydrophilic polyethylene glycol(PEG)chains,and terminal carboxyfluorescein(FAM)covalently linked together. | price> |
| R-R-0054 | DSPE acyl hydrazone bond PEG5000-MAL | DSPE acyl hydrazone bond PEG5000-MAL refers to the conjugation of distearyl phosphatidylethanolamine (DSPE) with a polyethylene glycol (PEG) polymer containing a maleimide (MAL) group through an acyl hydrazone bond. DSPE acyl hydrazone bond PEG5000-MAL conjugation offers a versatile approach for the modification of lipid-based drug delivery systems, providing improved stability, enhanced pharmacokinetics, and the opportunity for further functionalization. | price> |
| R-PL2057 | DSPE-PEOz-Folate | DSPE-PEOz-Folate1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-Poly(2-ethyl-2-oxazoline)-Folate, (sodium salt) | price> |
| R-Z59950 | DSPE-PEG-SPDP | DSPE-PEG can be coupled with targeted ligands(such as RGD peptides,trastuzumab) to achieve precise delivery by specifically binding to tumor cell surface receptors(such as HER2,integrins).The disulfide bond of SPDP(N-succinimidyl-3-(2-pyridyldithiol)propionate)can be broken in a reducing environment,enabling precise drug release in target cells and reducing its impact on healthy cells. | price> |
| R-9997 | DSPE-PEG-Angiopep-2 (CTFFYGGSRGKRNNFKTEEY) | DSPE-PEG2K-Angiopep-2,1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-(polyethylene glycol) -Angiopep-2 (CTFFYGGSRGKRNNFKTEEY) | price> |
| R-H0113 | DSPE-PEG2000-GE11 | DSPE-PEG-GE11,DSPE-PEG-peptides.1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-(polyethyleneglycol)-GE11 (sodium salt) | price> |
| R-C-7528 | DSPE-PEG-PLGLAGAAQYQDRYYDEFTWKEKDMDYW | DSPE-PEG2K-PLGLAGAAQYQDRYYDEFTWKEKDMDYW,DSPE acts as a hydrophobic tail and can be embedded into liposomes,micelles,or cell membranes.PEG(polyethylene glycol)acts as a hydrophilic linking arm,providing steric hindrance,prolonging in vivo circulation time,and reducing immunogenicity.DSPE-PEG can couple various peptides(PLGLAGAAQYQDRYYDEFTWKEKDMDYW) and other functional groups.This product is only for scientific research and cannot be used on the human body. | price> |
| RZ-141 | DSPE-PEG-KRWWKWWRR,MW:2K | DSPE-PEG-KRWWKWWRR is a multifunctional conjugate composed of phospholipids(DSPE),polyethylene glycol(PEG),and antimicrobial peptides(KRWWKWWRR),mainly used for the construction of drug delivery systems.The KRWWKWWRR peptide can specifically bind to targets, enhancing the carriers targeting of bacteria or diseased tissues. | price> |
| R-0302-2K | DSPE-HYD-PEG-RhB | Ruixi can provide 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-hyd-polyacetylene glycol-rhodamine.Rhodamine B has strong fluorescence in the solution.It can be used as cell fluorescent dye,colored glass,fireworks and other industries in the laboratory.The stereoprotective effect of PEG on liposomes depends on the molecular weight,chain length,flexibility,hydrophilicity and composition of phospholipid. | price> |
| R-DS-0031 | DSPE-PEG2000-OTC(D-Phe-c[Cys-Phe-D-Trp-Lys-Thr-Cys]-Thr-ol) | 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-polyethylene glycol-OTC(D-Phe-c[Cys-Phe-D-Trp-Lys-Thr-Cys]-Thr-ol)can be made into micelles and bind to a variety of tumor cells expressing somatostatin receptor and its subtype receptor SSTR2. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


