Product phospholipids -phospholipid-peg-customization

Home > products > phospholipids > phospholipid-peg-customization

Catalog	name	Description	price
R-C-7198	DSPE-PEG-CPLGLAGSRDIYSTDYYR(PEG-NH2)	DSPE-PEG-CPLGLAGSRDITDYYR is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CPLGLAGSRDITDYYR.Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,forming a structurally clear and functionally adjustable self-assembly system.	price>
R-C-7199	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH)	DSPE-PEG-CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) is a class of functionalized molecules constructed by chemical coupling of distearoyl phosphatidylethanolamine(DSPE),polyethylene glycol (PEG),and CGTHEPAKALTQTNSHSPLGLAGRYGWSFPYPQITG(PEG-SH) . Its core structure integrates the hydrophobic properties of DSPE,the hydrophilic stability of PEG,and the interface recognition or targeting ability of peptides through covalent bonds,Used to achieve targeted delivery or other functions.	price>
R-C-7200	DMPE-PEG-KYIKFKHDYNILEFNDGTFE-K-FI	DMPE is a phospholipid molecule containing myristoyl and phosphatidylcholine.The hydrophobic chain of DMPE facilitates its embedding in biological membranes or liposomes,enhancing the binding between molecules and membranes.PEG is a hydrophilic polymer used to increase the water solubility and biocompatibility of molecules.PEG has good flexibility,which can improve the solubility and stability of molecules,and reduce non-specific binding.It can couple various peptides(KYIKFKHDYNILEFNDGTFE-K-FI) and small molecule groups.	price>
R-C-5621	DSPE-PEG2000-TFFYGGSRGKRNNFKTEEY	The peptide sequence Angiopep-2 (TFFYGGSRGKRNNFKTEEYC) is a specific targeting peptide derived from the protein fibronectin. This peptide is known to have affinity for certain receptors or molecules present on the surface of specific cell types. By conjugating this peptide to DSPE-PEG2000, the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells.	price>
R-C-7201	DSPE-TK-PEG-CSTSMLKAC	DSPE-TK-PEG-CTSSMLKAC is a ROS responsive nanomaterial that combines phospholipids,polyethylene glycol(PEG),and cardiac targeting peptides(CSTSMLKAC).It has targeted delivery and controlled release functions and is mainly used in the treatment of myocardial diseases or drug delivery systems Thioketal is a ROS responsive linker that can be cleaved in high reactive oxygen species(ROS)environments,enabling controlled drug release.	price>
R-C-5622	DSPE-PEG2000-CLSSRLDAC	DSPE(1,2-distearoyl-sn-glycero-3-phosphoethanolamine) is a phospholipid that can integrate into the lipid bilayer of liposomes or nanoparticles.PEG2000 refers to the attachment of a polyethylene glycol (PEG) polymer chain of approximately 2000 Daltons in size,providing stealth properties to the formulation and increasing its circulation time in the bloodstream.The peptide sequence CLSSRLDAC is a specific targeting peptide with affinity for certain receptors or molecules present on the surface of specific cells.By conjugating this peptide to DSPE-PEG2000,the liposomes or nanoparticles can potentially target and bind to the corresponding receptors on specific cells.	price>
R-C-5623	DSPE-PEG2000-CLPVASC	DSPE-PEG-CLPVASC,The hydrophobic anchoring part is also based on the DSPE skeleton; The intermediate connecting unit is a polyethylene glycol (PEG) segment; Terminal coupled CLPVASC peptide segment, which has specific recognition function; The overall molecular weight varies with PEG length and peptide composition, commonly ranging from 3000-6000 Da; it can self assemble into micelles or embed into lipid bilayer structures in buffered aqueous solutions.	price>
R-C-7203	DLPE-PEG-NTA-Ni	NTA-Ni-PEG-DLPE,1,2-Dilauroyl-sn-glycero-3-phosphoethanolamine(DLPE)is an important phospholipid compound.As a component analog of cell membranes,it can be used to construct artificial liposomes,simulate the properties and functions of biological membranes,and help study the interactions between membrane proteins and membranes.NTA is a metal ion chelating ligand that is particularly suitable for forming stable complexes with nickel ions(Ni).	price>
R-C-5624	DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP	DSPE-PEG2K-CPLGLAG-GGYTFHWHRLNP,(DSPE) polyethyleneglycol is a combination of phospholipid and polyethylene glycol,which has hydrophilicity and hydrophobicity.Polyethylene glycol liposomes were used to form high-quality materials.It can be used for drug delivery,gene transfection and vaccine delivery.We can also customize various products with different molecular weights.	price>
R-C-7204	DPPE-PEG-NTA-Ni	NTA-Ni-PEG-DPPE,DPPE-PEG-NTA-Ni is a modular amphiphilic molecule used mainly for His-tag protein capture,membrane functionalization,or nanoparticle surface modification.NTA is a metal ion chelating ligand that is particularly suitable for forming stable complexes with nickel ions(Ni).	price>

...