| Catalog | name | Description | price |
|---|---|---|---|
| R-C-5944 | DSPE-PEG2k-CGPLGVRGDK-DBCO | DBCO(Dibenzylcyclooctyne) reagents can be used to label azide-modified biomolecules spontaneous without the need for toxic Cu catalysts.The reaction of azides with strained alkynes,such as cyclooctynes, readily forms a triazole product without the need for a toxic catalystPEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins.It can also suppress the non-specific binding of charged molecules to the modified surfaces.It can also couple various peptides. | price> |
| R-C-7525 | DSPE-Hyd-PEG-CAIX | DSPE-Hyd-PEG-CAIX is a functionalized phospholipid targeted conjugate,and its structure includes hydrophilic and hydrophobic regions,which helps to form stable assemblies.CAIX is a transmembrane protein highly expressed in a variety of solid tumors(such as kidney cancer, breast cancer,colorectal cancer),a key regulator of tumor microenvironment acidification,and an important tumor targeting marker.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-7526 | DSPE-GNYTCEVTELSREGKTVIELK | GNYTCEVTELSREGKTVIELK-DSPE,DSPE as a lipid anchoring group,can stably embed into the bilayer of liposomes,lipid nanoparticles(LNP),or cell membranes, providing structural integration capability.GNYTCEVTELSREGKTIELK is a mimic peptide sequence of CD47 protein,which can bind to the signal regulatory protein alpha(SIRP alpha)on the surface of macrophages,transmit self recognition signals,inhibit phagocytosis,and prolong the circulation time of nanocarriers in vivo.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-7527 | DSPE-PEG-GNYTCEVTELSREGKTVIELK | DSPE-PEG2K-GNYTCEVTELSREGKTVIELK,GNYTCEVTELSREGKTVIELK-PEG-DSPE,DSPE-PEG-CD47,DSPE-PEG-GNYTCEVTESREGKTIELK is a functionalized phospholipid conjugate.DSPE acts as a hydrophobic tail and can be embedded into liposomes, micelles, or cell membranes.PEG (polyethylene glycol)acts as a hydrophilic linking arm,providing steric hindrance,prolonging in vivo circulation time,and reducing immunogenicity.GNYTCEVTELSREGKTIELK is a functional mimic peptide of CD47 protein,which can bind to the SIRP α receptor on the surface of macrophages, transmit the dont eat mesignal,significantly inhibit phagocytosis,and improve the in vivo stability and targeted enrichment efficiency of nanocarriers.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-7529 | DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR | DSPE-PEG-CGLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR is a highly functionalized phospholipid polyethylene glycol peptide conjugate designed for efficient delivery of biomolecules(such as CRISPR RNP complexes,siRNA,or proteins)into specific cells(especially T cells).This molecule combines multiple mechanisms including lipid anchoring,long circulation protection,membrane fusion penetration,and nuclear localization.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-7530 | DSPE-PEG-SFSHHTPILPLCK-RB | DSPE-PEG-SFSHHTPILPLCK-RB is a liver cancer targeted fluorescent labeled liposome construction material suitable for molecular imaging and biological detection of liver cancer cells Constructing targeted nanocarriers to achieve precise delivery of drugs or genes Used for tumor diagnosis, targeted therapy, and efficacy evaluation research.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-7531 | DSPE-PEG-IFLLWQRCRR(MAL-SH) | DSPE-PEG2K-IFLLWQRCRR(MAL-SH),IFLLWQRCRR-PEG-DSPE,DSPE-PEG-IFLLWQRCRR is a functionalized phospholipid polyethylene glycol(DSPE-PEG)conjugate that can be used to construct tumor targeted nano drug carriers,achieve precise delivery of chemotherapy drugs or gene drugs, improve drug penetration efficiency in deep tumor tissues,and be used for the development of tumor imaging probes or diagnostic reagents.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-7536 | DSPE-TK-PEG-FcBP((FcBP cyclic peptide) Pen (3) forms a loop with Cys (13)) | DSPE-TK-PEG-H-Arg-Phe-Pen-Thr-Gly-His-Phe-Gly-Sar-NMeLeu-Tyr-Pro-Cys(FcBP cyclic peptide) Pen(3)forms a loop with Cys(13),DSPE-TK-PEG-FcBP(cyclic)is widely used to construct intelligent responsive nanomedicine delivery systems,with membrane anchoring,stimulus responsive release,and active targeting capabilities.FcBP(Fc Binding Peptide)is a peptide sequence that can bind to immunoglobulin Fc fragments or Fc receptors,commonly used to enhance cellular uptake or achieve cross barrier transport;When it is a cyclic structure(such as the covalent ring formed by Pen(3)and Cys(13)),it has higher conformational stability and target affinity.This product is only for scientific research and cannot be used on the human body. | price> |
| R-C-5965 | Gd-DOTA-C6-DSPE | DSPE-C6-DOTA-Gd,Gd-DOTA-C6-DSPE is often used in the formulation of lipid-based nanoparticles for drug delivery,imaging, or theranostic applications (combined diagnostic and therapeutic functions).The Gd-DOTA complex provides the contrast agent properties for imaging, and the DSPE component facilitates the incorporation of the molecule into lipid-based nanoparticle systems. | price> |
| R-C-7571 | DSPE-PEG-CSBP(ldvflyse) | DSPE-PEG2k-CSBP(ldvflyse),DSPE is distearoyl phosphatidylethanolamine,containing two saturated 18 carbon fatty acid chains that can be embedded in lipid bilayers or spontaneously assembled into hydrophobic cores.PEG is a hydrophilic biodegradable material that provides spatial stability and reduces non-specific adsorption.The process of CSBP induced tumor cell phagocytosis is by changing the molecular expression or signal transduction on the surface of tumor cells, making them more easily recognized and engulfed by immune cells, thereby enhancing anti-tumor immune effects.This product is only for scientific research and cannot be used on the human body. | price> |

Items-$0.00

Email:
Tel.:
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


